Recombinant Danio rerio Tetraspanin-31 (tspan31)

What is Tetraspanin-31 (tspan31) and what is its significance in Danio rerio?

Tetraspanin-31 (tspan31) is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. In Danio rerio (zebrafish), this protein functions as a cell-surface protein characterized by four hydrophobic domains. Tetraspanins mediate signal transduction events that play critical roles in regulating cell development, activation, growth, and motility. Tspan31 specifically is involved in growth-related cellular processes and serves as a molecular scaffold that anchors proteins at cell and organelle membranes within tetraspanin-enriched microdomains . In humans, the homologous protein has been associated with tumorigenesis and osteosarcoma, suggesting conserved functions across species . Understanding tspan31 in zebrafish provides valuable insights into fundamental cellular processes and potential disease mechanisms.

What is the amino acid sequence and structural characteristics of Danio rerio tspan31?

The full amino acid sequence of Danio rerio tspan31 is:
MVCGGFTCSKNALCSLNVVYMLVGLLLIVVAAWGKGFGIVSSIHIIGGVIAVGFFLQLIAIVGLIGAVHHHQVMLFFYMVILFVVFLFQFGVSCSCLAMNQGQQEKLLESSWKIMSNDTRISLEKKLDC CGLFNSTNLQADIMSDLHLCTSPCTQKKECVTCGLKMLQHSSEALIKILGGVGLFFSFEILGVWLAMRYRNQKDPRANPSAFL .

How should recombinant Danio rerio tspan31 be properly stored and handled?

For optimal stability and activity, recombinant Danio rerio tspan31 should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C . Repeated freezing and thawing is not recommended as this can lead to protein denaturation and loss of activity. Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for maintaining protein stability .

For reconstitution of lyophilized protein, sterile water should be added to prepare a stock solution, followed by gentle centrifugation at 4°C before opening to recover the entire contents . When handling the protein, it is advisable to work in sterile conditions and use protein-low binding tubes to prevent loss of material through adhesion to tube walls. For experimental use, maintaining physiological pH (typically pH 7.4) and ionic strength is recommended to preserve protein function.

What expression systems are most effective for producing functional recombinant Danio rerio tspan31?

The choice of expression system for recombinant Danio rerio tspan31 depends on experimental requirements for protein yield, post-translational modifications, and downstream applications. Based on successful approaches with tetraspanins, several systems can be recommended:

For functional studies, mammalian expression systems are generally preferred as they ensure proper glycosylation, which is crucial since defects in N-glycosylation can lead to endoplasmic reticulum retention as observed with mutant Tspan3c .

What purification strategies are most effective for isolating recombinant Danio rerio tspan31?

Purification of recombinant Danio rerio tspan31 requires specialized approaches due to its membrane protein nature. An effective multi-step purification strategy includes:

• Affinity Chromatography: Using tagged recombinant proteins (His, Fc, or other fusion tags) allows for efficient initial capture. For example, His-tagged tspan31 can be purified using nickel or cobalt affinity resins .

• Detergent Solubilization: Prior to purification, membrane proteins require extraction from membranes using detergents. Mild detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin preserve protein structure and function.

• Size Exclusion Chromatography: This step separates protein aggregates and contaminants based on molecular size. The recombinant human TSPAN31/mFc has a predicted molecular mass of 35.9 kDa but appears as approximately 40-46 kDa in SDS-PAGE due to glycosylation .

• Ion Exchange Chromatography: This can provide additional purification based on the protein's charge properties.

Quality control should include SDS-PAGE analysis (>95% purity), endotoxin testing (<1.0 EU per μg), and functional assays to confirm biological activity. Western blotting with specific antibodies can confirm identity, while dynamic light scattering assesses aggregation state.

How can I design experiments to study tspan31's role in zebrafish pigment cell interactions?

To investigate tspan31's role in zebrafish pigment cell interactions, a multi-faceted experimental approach can be implemented:

• In vivo Analysis of Pigment Patterns:

  • Generate tspan31 mutant lines using CRISPR/Cas9 targeting different domains

  • Perform detailed phenotypic analysis of pigment patterns across developmental stages

  • Use time-lapse imaging to track melanophore and xanthophore interactions in wild-type versus mutant fish

• Cell Culture Assays:

  • Isolate melanophores and xanthophores from wild-type and tspan31 mutant zebrafish

  • Conduct co-culture experiments to assess cell-cell interactions and boundary formation

  • Perform motility assays to quantify cell migration defects as observed in the dali mutant

• Molecular Mechanism Studies:

  • Use immunoprecipitation to identify tspan31 protein interaction partners

  • Analyze subcellular localization of tspan31 using fluorescently tagged constructs

  • Examine N-glycosylation patterns and their effect on protein trafficking and function

Studies on the related tetraspanin 3c (tspan3c) revealed that melanophores in mutants have defects in motility and interactions with xanthophores, leading to abnormal pigment patterning . Similar experimental designs could be adapted for tspan31, with precise phenotypic assessment of stripe boundary formation and maintenance.

How do post-translational modifications affect tspan31 function and localization?

Post-translational modifications, particularly N-glycosylation and palmitoylation, profoundly impact tspan31 function and localization. Research methodologies to investigate these effects include:

• N-glycosylation Analysis:

  • Site-directed mutagenesis of predicted N-glycosylation sites (Asn-X-Ser/Thr motifs)

  • Treatment with tunicamycin to inhibit N-glycosylation or endoglycosidases to remove glycans

  • Lectin blotting to characterize glycan structures

Research on related tetraspanins has shown that defects in N-glycosylation can lead to protein retention in the endoplasmic reticulum, preventing proper membrane localization . The dali mutant of tspan3c exhibits a defect in N-glycosylation that causes ER retention, disrupting its function in pigment cell interactions .

• Palmitoylation Studies:

  • Metabolic labeling with palmitate analogs

  • Site-directed mutagenesis of conserved cysteine residues

  • Acyl-biotin exchange chemistry to detect palmitoylated proteins

Palmitoylation of tetraspanins affects their association with lipid rafts and interaction partners. For instance, studies on CD81 showed that increased palmitoylation within lipid raft microdomains influences its signaling properties .

• Localization Analysis:

  • Immunofluorescence microscopy with organelle markers

  • Live-cell imaging with fluorescently tagged tspan31

  • Subcellular fractionation followed by western blotting

These approaches can determine whether modifications affect trafficking to the plasma membrane or localization within tetraspanin-enriched microdomains.

What are the molecular mechanisms underlying tspan31's role in cell migration and adhesion?

Tetraspanins, including tspan31, regulate cell migration and adhesion through complex mechanisms involving protein-protein interactions within tetraspanin-enriched microdomains. To elucidate these mechanisms for tspan31, several experimental approaches can be employed:

• Interaction Partner Identification:

  • Proximity labeling techniques (BioID, APEX)

  • Co-immunoprecipitation coupled with mass spectrometry

  • Yeast two-hybrid screening for cytoplasmic domain interactions

• Functional Adhesion Assays:

  • Cell attachment assays to various extracellular matrix components

  • Cell spreading analysis using real-time impedance measurements

  • Formation of focal adhesions visualized by paxillin or vinculin staining

• Migration Studies:

  • Wound healing/scratch assays

  • Transwell migration and invasion assays

  • Single-cell tracking with time-lapse microscopy

Studies with tetraspanins have shown they can regulate integrin-dependent cell adhesion and migration. For example, CD151 and Tspan32 positively regulate "outside-in" signaling of platelet integrin αIIbβ3, affecting platelet aggregation and spreading on fibrinogen . Similarly, tspan31 likely modulates adhesion receptor function, cytoskeletal reorganization, and signaling pathway activation to influence cell movement and attachment.

How does tspan31 function in zebrafish compare to its homologs in mammalian systems?

Comparative analysis of tspan31 function between zebrafish and mammalian systems provides evolutionary insights and translational relevance. Research approaches include:

• Sequence and Structure Comparison:

  • Phylogenetic analysis of tspan31 across species

  • Protein structure prediction and alignment

  • Identification of conserved functional domains and motifs

• Expression Pattern Analysis:

  • Tissue-specific expression profiling in zebrafish and mammalian models

  • Developmental expression timelines

  • Single-cell RNA sequencing to identify cell type-specific expression

• Functional Conservation Testing:

  • Cross-species rescue experiments (mammalian tspan31 in zebrafish mutants)

  • Comparative protein interaction studies

  • Parallel phenotypic analysis in zebrafish and mouse models

While zebrafish tspan31 is expressed in melanophores and xanthophores and affects pigment patterning , human TSPAN31 is associated with tumorigenesis and osteosarcoma . This suggests both conserved roles in cell growth and migration, and species-specific functions. The human TSPAN31 gene is located at chromosome 12q13-q14 , while comparative genomic analysis could reveal syntenic relationships with the zebrafish ortholog.

What are common challenges in generating functional tspan31 mutants in zebrafish and how can they be overcome?

Creating and characterizing functional tspan31 mutants in zebrafish presents several technical challenges. Here are effective strategies to address them:

• Target Selection Challenges:

  • Problem: Choosing mutation sites that affect function without causing lethality

  • Solution: Target conserved regions based on alignment with known functional mutations like the dali mutation in tspan3c . Consider introducing mutations that mimic human disease variants.

  • Validation: Use protein structure predictions to assess potential functional impacts before generating mutants

• Mutagenesis Efficiency Issues:

  • Problem: Low efficiency or off-target effects with CRISPR/Cas9

  • Solution: Design multiple guide RNAs using algorithms that minimize off-targets; use Cas9 variants with higher specificity

  • Validation: Sequence multiple F0 fish to select founders with desired mutations and minimal off-target effects

• Phenotypic Analysis Complexities:

  • Problem: Subtle or variable phenotypes that are difficult to quantify

  • Solution: Develop standardized imaging protocols and quantitative metrics for pigment pattern analysis; use automated image analysis software

  • Validation: Compare results across multiple clutches and generations to account for background genetic variation

• Compensatory Mechanisms:

  • Problem: Genetic compensation masking mutant phenotypes

  • Solution: Generate conditional knockouts or use morpholinos for acute depletion; consider double mutants with related tetraspanins

  • Validation: Perform RNA-seq to identify upregulated genes that might compensate for tspan31 loss

Successful mutant generation should be followed by thorough molecular validation (RT-PCR, Western blotting) to confirm the mutation impacts protein expression or function as expected.

How can I optimize immunodetection methods for studying tspan31 expression and localization?

Optimizing immunodetection of tspan31 requires addressing the challenges associated with membrane proteins:

• Antibody Selection and Validation:

  • Challenge: Limited availability of specific antibodies against zebrafish tspan31

  • Strategy: Generate custom antibodies against unique extracellular loops or use epitope tagging (HA, FLAG, GFP) of recombinant protein

  • Validation: Confirm specificity using western blots of wild-type versus tspan31 knockout/knockdown samples

• Sample Preparation for Immunohistochemistry:

  • Challenge: Preserving membrane protein epitopes during fixation

  • Strategy: Compare multiple fixation methods (4% PFA, Bouin's, methanol); optimize fixation time; use antigen retrieval methods

  • Protocol:

    1. Fix zebrafish embryos/tissues in 4% PFA for 2-4 hours at 4°C

    2. Perform careful permeabilization (0.1% Triton X-100, 10-15 minutes)

    3. Block with 5-10% serum containing 1% BSA

• Detection in Western Blots:

  • Challenge: Protein aggregation during sample preparation

  • Strategy: Use specialized lysis buffers containing appropriate detergents (DDM, CHAPS); avoid boiling samples; use urea-based buffers for difficult samples

  • Protocol:

    1. Lyse cells/tissues in buffer containing 1% DDM, protease inhibitors

    2. Incubate at 37°C (not 95°C) with sample buffer

    3. Use gradient gels (4-15%) for better resolution

• Co-localization Studies:

  • Challenge: Distinguishing specific localization in membrane microdomains

  • Strategy: Use super-resolution microscopy (STED, STORM); perform co-staining with markers for cellular compartments

  • Analysis: Calculate Pearson's correlation coefficients for quantitative assessment of co-localization

These methodologies can be adapted based on specific experimental needs and available resources.

What emerging technologies can advance our understanding of tspan31 function in zebrafish?

Several cutting-edge technologies offer promising approaches to deepen our understanding of tspan31 biology:

• CRISPR Activation/Interference (CRISPRa/CRISPRi):

  • Enables precise modulation of tspan31 expression without altering the genetic sequence

  • Allows temporal and spatial control when combined with tissue-specific promoters

  • Can reveal dosage-dependent functions that complete knockout studies might miss

• Optogenetics for Protein Interaction Analysis:

  • Light-inducible dimerization systems to control tspan31 interactions in real-time

  • Enables precise temporal control of protein function in specific cell types

  • Can reveal dynamic changes in signaling cascades following tspan31 activation

• Single-cell Multi-omics:

  • Single-cell RNA-seq to identify cell type-specific expression patterns

  • Single-cell ATAC-seq to uncover regulatory mechanisms controlling tspan31 expression

  • Spatial transcriptomics to map expression patterns within tissue microenvironments

• Advanced Imaging Techniques:

  • Lattice light-sheet microscopy for long-term imaging of cell interactions with minimal phototoxicity

  • Correlative light and electron microscopy (CLEM) to connect ultrastructural details with functional imaging

  • Live super-resolution microscopy to visualize tetraspanin-enriched microdomains in real-time

• Interactome Mapping:

  • Proximity labeling methods (BioID, APEX) to identify context-specific interaction partners

  • Cross-linking mass spectrometry to capture transient interactions

  • Hydrogen-deuterium exchange mass spectrometry to reveal structural dynamics

These technologies, used in combination, could provide unprecedented insights into how tspan31 functions in tetraspanin-enriched microdomains to regulate cell behavior in normal development and disease states.

How might tspan31 research in zebrafish translate to understanding human disease mechanisms?

Research on tspan31 in zebrafish has significant translational potential for understanding human disease mechanisms:

• Cancer Biology Applications:

  • Human TSPAN31 is associated with tumorigenesis and osteosarcoma

  • Zebrafish models can provide insights into how altered tspan31 function contributes to cancer progression

  • High-throughput drug screening in zebrafish tspan31 models can identify potential therapeutic compounds

• Developmental Disorders:

  • Tspan31's role in cell migration and adhesion suggests it may impact various developmental processes

  • Zebrafish models can help understand how mutations affect organogenesis and tissue patterning

  • The visible pigmentation phenotypes provide an accessible readout for screening genetic interactions

• Regenerative Medicine:

  • Understanding tspan31's role in cell behavior could inform tissue engineering approaches

  • Zebrafish regeneration studies can reveal how tspan31 contributes to tissue repair mechanisms

  • Manipulation of tspan31 function might enhance regenerative capacity in clinical applications

• Comparative Disease Modeling:

  • Create zebrafish models with human patient-specific tspan31 mutations

  • Compare phenotypes with clinical presentations to validate disease mechanisms

  • Test potential therapeutic interventions in a vertebrate model system

A data-driven approach combining human genomic data with zebrafish functional studies can accelerate the translation of basic tspan31 research into clinical applications for disorders involving cell migration, adhesion, and signaling dysregulation.

How should contradictory results in tspan31 function studies be reconciled and analyzed?

When faced with contradictory results in tspan31 research, a systematic approach to reconciliation includes:

• Methodological Differences Analysis:

  • Create a comprehensive comparison table of experimental conditions across studies

  • Identify key variables: protein tags, expression levels, cell types, assay conditions

  • Determine if contradictions are method-dependent rather than biologically meaningful

• Context-Dependent Function Assessment:

  • Tetraspanins often exhibit different functions in different cellular contexts

  • Studies on related tetraspanins like CD81 have shown contradictory results in B cell receptor signaling, with some reporting CD81 as essential for sustained signaling while others found it to be a negative regulator

  • Systematically test tspan31 function across different cell types and conditions

  Study Context	Observed Function	Experimental Approach	Potential Explanations for Differences
  Context A	Positive regulator	Method X	Expression level differences
  Context B	Negative regulator	Method Y	Interaction partner availability
  Context C	No significant effect	Method Z	Compensatory mechanisms

• Integrative Data Analysis:

  • Use meta-analysis approaches to identify consistent trends across studies

  • Apply systems biology modeling to integrate contradictory data points

  • Consider temporal dynamics that might explain apparently contradictory steady-state observations

• Direct Replication Studies:

  • Design experiments that directly test contradictory findings under identical conditions

  • Include positive and negative controls to validate assay performance

  • Collaborate with groups reporting contradictory results to identify subtle methodological differences

When interpreting results, it's important to consider that tetraspanins like tspan31 function as molecular scaffolds within complex protein networks, and their effects may be highly dependent on the specific molecular environment of different experimental systems.

What statistical approaches are most appropriate for analyzing tspan31 knockout phenotypes in zebrafish?

Proper statistical analysis of tspan31 knockout phenotypes requires careful consideration of experimental design and data characteristics:

• Experimental Design Considerations:

  • Use power analysis to determine appropriate sample sizes (typically n≥30 fish per condition)

  • Include multiple independent knockout lines to control for off-target effects

  • Consider clutch effects and control for genetic background variation

• Phenotypic Data Analysis Approaches:

  • For continuous variables (cell migration speed, stripe width, etc.):

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Apply parametric tests (t-test, ANOVA) for normally distributed data

    • Use non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal distributions

  • For categorical data (presence/absence of phenotype, pattern classifications):

    • Apply chi-square or Fisher's exact tests

    • Consider ordinal logistic regression for severity classifications

• Longitudinal Data Analysis:

  • Use repeated measures ANOVA or mixed-effects models for time-series data

  • Apply survival analysis techniques for time-to-event data (e.g., time to develop abnormal pigmentation)

• Multiple Testing Correction:

  • Apply Bonferroni correction for small numbers of planned comparisons

  • Use Benjamini-Hochberg procedure to control false discovery rate in large-scale analyses

  • Consider hierarchical testing procedures to maintain statistical power

• Effect Size Reporting:

  • Report Cohen's d, odds ratios, or mean differences with confidence intervals

  • Include biological significance assessment alongside statistical significance

Example of data presentation for pigment cell interaction analysis:

*p<0.05, ***p<0.001 compared to wild-type (with appropriate statistical test indicated in figure legend)