Recombinant Danio rerio Threonylcarbamoyladenosine tRNA methylthiotransferase (cdkal1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Threonylcarbamoyladenosine tRNA methylthiotransferase, commonly known as cdkal1 in Danio rerio, belongs to the family of enzymes responsible for post-transcriptional modification of transfer RNA molecules . In zebrafish, this protein is encoded by the cdkal1 gene, also annotated as zgc:65864 in genomic databases . The enzyme functions as a methylthiotransferase that catalyzes specific modifications on tRNA molecules, which are critical for proper translation processes and protein synthesis regulation .

Evolutionary Conservation

The cdkal1 protein represents a highly conserved enzyme across vertebrate species, indicating its fundamental importance in biological processes. As a CDK5 regulatory subunit associated protein 1-like 1, it shares structural and functional similarities with its counterparts in other organisms, including humans, mice, and other model species . This conservation underscores the evolutionary significance of tRNA modification mechanisms in eukaryotic cellular function and development.

Biological Significance

Zebrafish have emerged as an important model organism for studying vertebrate development due to their rapid and well-characterized embryonic stages . The expression and activity of cdkal1 in Danio rerio have gained particular attention because tRNA modifications appear to undergo dynamic changes during critical developmental transitions. Research suggests that these modifications may contribute to the precise regulation of protein synthesis required for proper embryonic development .

Protein Structure

Recombinant Danio rerio cdkal1 maintains the characteristic structural domains associated with tRNA methylthiotransferases. The protein contains specific catalytic regions responsible for its enzymatic activity in transferring methylthio groups to target tRNA molecules . While detailed structural information specific to the zebrafish variant remains limited in the available literature, comparative analyses with homologs from other species suggest a conserved three-dimensional configuration that supports its specialized function.

Enzymatic Activity

As a threonylcarbamoyladenosine tRNA methylthiotransferase (EC 2.8.4.5), cdkal1 catalyzes the methylthiolation of specific adenosine residues in tRNA molecules . This enzymatic function contributes to the extensive post-transcriptional modification landscape of tRNAs, where up to 20% of nucleotides may be modified at the sugar or base moiety . These modifications are crucial for tRNA stability, folding, and proper codon recognition during translation.

Physical and Chemical Properties

Commercially available recombinant Danio rerio cdkal1 protein is typically produced with a purity of greater than or equal to 85% as determined by SDS-PAGE analysis . The protein can be obtained in both full-length and partial constructs, depending on the specific research requirements . Standard biochemical characterization confirms its identity and activity through various analytical methods, ensuring consistency for research applications.

Expression Systems

Recombinant Danio rerio cdkal1 is primarily produced using cell-free expression systems, which offer advantages in terms of rapid production and reduced complications from host cell interactions . Additionally, the protein can be expressed in various heterologous systems including E. coli, yeast, baculovirus-infected insect cells, or mammalian cell cultures . Each expression platform provides different benefits regarding protein folding, post-translational modifications, and yield.

Purification Techniques

The purification of recombinant cdkal1 typically involves multiple chromatographic steps to achieve the desired purity level. Standard protocols employ affinity chromatography, often utilizing fusion tags to facilitate selective binding and elution . This is commonly followed by size exclusion and/or ion exchange chromatography to remove contaminants and ensure homogeneity. Quality control assessments, including SDS-PAGE analysis, confirm that the final product meets the established purity threshold of ≥85% .

Quality Control Parameters

The quality of recombinant Danio rerio cdkal1 is assessed through multiple parameters, including:

ParameterStandard SpecificationAnalytical Method
Purity≥85%SDS-PAGE
IdentityConfirmation of amino acid sequenceMass spectrometry
ActivityEnzymatic function verificationBiochemical assays
ContaminantsEndotoxin levels, bioburdenLAL test, microbial testing
StabilityShelf-life determinationAccelerated stability studies

These rigorous quality control measures ensure that the recombinant protein meets research-grade standards for experimental applications .

Mechanism of tRNA Methylthiolation

Threonylcarbamoyladenosine tRNA methylthiotransferase catalyzes the transfer of a methylthio group to specific adenosine residues in tRNA molecules, particularly at position 37 (t6A37) . This modification is crucial for maintaining proper tRNA structure and function. The enzyme utilizes S-adenosylmethionine (SAM) as a methyl donor and iron-sulfur clusters as cofactors to facilitate this biochemical transformation, contributing to the diverse landscape of tRNA modifications .

Impact on tRNA Function

The methylthiolation of tRNA by cdkal1 significantly influences several aspects of tRNA functionality:

  1. Enhanced codon recognition accuracy

  2. Improved translational fidelity

  3. Stabilized tRNA tertiary structure

  4. Prevention of frameshifting during translation

  5. Regulation of translation efficiency for specific mRNAs

These effects collectively contribute to the precise regulation of protein synthesis, which is particularly critical during developmental processes when translational demands change dynamically .

Developmental Dynamics

Recent research utilizing advanced sequencing approaches such as tRAM-seq has revealed that tRNA expression and modification profiles undergo significant changes during zebrafish embryonic development . Evidence suggests a major switch in tRNA isodecoder expression and modification profiles occurs around the start of gastrulation . These findings indicate that cdkal1 activity might be developmentally regulated, contributing to stage-specific requirements for protein synthesis during embryogenesis .

Developmental Expression Patterns

Studies examining tRNA modification landscapes in Danio rerio have demonstrated that the activity of tRNA modification enzymes, including cdkal1, exhibits distinct patterns throughout embryonic development . The observed dynamic changes in tRNA modification profiles suggest a coordinated reprogramming of the translational machinery to meet the changing protein synthesis requirements during different developmental stages .

Regulatory Mechanisms

The regulation of cdkal1 expression and activity in zebrafish appears to be integrated with broader developmental programs. Although the specific regulatory mechanisms controlling cdkal1 during zebrafish development remain partially characterized, research indicates that its function contributes to the fine-tuning of protein synthesis machinery during critical developmental transitions . This regulation may involve transcriptional control, post-translational modifications, or interactions with other cellular factors.

Impact on Embryogenesis

The dynamic expression and activity of cdkal1 during zebrafish embryogenesis suggest its importance in supporting proper development. The modification of tRNAs by cdkal1 likely influences the efficiency and accuracy of translation for specific subsets of mRNAs, potentially facilitating developmental stage-specific protein synthesis programs . This specialized regulation may be particularly critical during the transition from maternal to zygotic gene expression and during gastrulation when cell fates become progressively determined.

Research Applications and Tools

The study of cdkal1 and its tRNA modification activities has been advanced by several methodological approaches:

  1. tRAM-seq (tRNA Amplification and sequencing) for comprehensive tRNA expression and modification profiling

  2. Mass spectrometry for direct detection of modified nucleosides

  3. Next-generation sequencing strategies that harness sequencing errors for detection of RNA modifications

  4. Improved mapping strategies to investigate tRNA expression and modification

These techniques have collectively enhanced researchers' ability to investigate the dynamics of tRNA modifications during developmental processes .

Model System Applications

Zebrafish serves as an excellent vertebrate model for studying cdkal1 function due to several advantages:

  1. Rapid and externally observable embryonic development

  2. Well-characterized developmental stages

  3. Genetic tractability

  4. Transparency of embryos facilitating imaging studies

  5. Evolutionary conservation of tRNA modification pathways

These features make Danio rerio an ideal system for investigating the developmental roles of tRNA modifications catalyzed by cdkal1 .

Evolutionary Conservation

Threonylcarbamoyladenosine tRNA methylthiotransferase exhibits remarkable evolutionary conservation across diverse species, from invertebrates like Drosophila and Caenorhabditis elegans to vertebrates including Xenopus, zebrafish, mice, and humans . This conservation underscores the fundamental importance of tRNA modification in eukaryotic cellular function. The table below summarizes cdkal1 homologs identified across different species:

SpeciesGene NameAlternative DesignationNotable Features
Danio reriocdkal1zgc:65864Subject of this review
Homo sapiensCDKAL1-Associated with type 2 diabetes risk
Mus musculusCdkal11190005B03Rik, 6620401C13RikMultiple isoforms identified
Xenopus laeviscdkal1cdkal1.SS homeolog specified
Xenopus tropicaliscdkal1-Highly similar to X. laevis
Drosophila melanogasterCG6550DmelCG6550Functionally conserved
Caenorhabditis elegansY92H12BL.1-Functionally conserved

This comparative perspective highlights both the core conservation and species-specific adaptations of this important enzyme family .

Functional Variations

While the core enzymatic function of cdkal1 appears conserved across species, subtle variations in substrate specificity, regulatory mechanisms, and developmental timing may exist. These differences likely reflect species-specific adaptations in translational regulation and developmental programs. The zebrafish variant offers particular advantages for studying developmental dynamics due to the experimental accessibility of the model system .

Disease Associations

In humans, variations in the CDKAL1 gene have been associated with increased risk for type 2 diabetes and other metabolic disorders, highlighting the clinical relevance of this enzyme family. While such associations have not been explicitly reported for the zebrafish ortholog in the available search results, the evolutionary conservation suggests potential value in using Danio rerio as a model to investigate the fundamental mechanisms that might underlie these disease associations.

Technological Advances

Emerging technologies are poised to further advance our understanding of cdkal1 function in zebrafish:

  1. CRISPR-Cas9 gene editing for precise manipulation of cdkal1 in vivo

  2. Single-cell transcriptomics to resolve cell-type specific expression patterns

  3. Advanced imaging techniques to visualize tRNA modification dynamics in real-time

  4. Improved computational methods for analyzing the complex landscapes of tRNA modifications

These technological developments will facilitate more precise investigation of cdkal1's role in tRNA modification and developmental regulation .

Unexplored Research Questions

Several important questions remain to be addressed regarding Danio rerio cdkal1:

  1. How is cdkal1 expression and activity regulated during specific developmental transitions?

  2. Which specific tRNA substrates are modified by cdkal1 in zebrafish, and how does this substrate specificity change during development?

  3. What are the downstream effects of cdkal1-mediated tRNA modifications on the translation of specific mRNAs?

  4. How do environmental factors influence cdkal1 activity and subsequent developmental outcomes?

Addressing these questions will provide deeper insights into the fundamental mechanisms of translational regulation during vertebrate development .

Potential Applications

Research on recombinant Danio rerio cdkal1 may lead to several valuable applications:

  1. Development of more specific tools for manipulating tRNA modification in research settings

  2. Insights into evolutionary conservation of translational regulation mechanisms

  3. Improved understanding of the molecular basis for developmental disorders

  4. Potential therapeutic strategies targeting tRNA modification pathways in disease contexts

These applications highlight the broader significance of fundamental research on tRNA modification enzymes like cdkal1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cdkal1; zgc:65864; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDK5 regulatory subunit-associated protein 1-like 1; tRNA-t(6A37 methylthiotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-547
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cdkal1
Target Protein Sequence
MMALVCDTAVDDIEDMVRITDVTPLQRQAARKSVVPRARKHKQETGEQMQTDSVIPGMQK VWLKTWGCSHNSSDGEYMAGQLAVAGYQITEDSSDADLWLLNSCTVKSPAEDHFRNAIRK AQEQNKKVVLAGCVPQAQPRMDYIKDLSIIGVQQIDRVVEVVDEAIKGHSVRLLGQKKEK GKRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGDLASYPVEELVERVRQS FQEGVCEIWLTSEDTGAYGRDIGSDLPTLLWRLVEEIPEGAMLRLGMTNPPYILEHLEEM SRILQHPRVFSFLHVPLQSASDSVLMEMRREYCCADFTHLVDYLKERVPGITIATDIICG FPGETDEDFEQTLALVRRYRFPSLFINQFYPRPGTPAALMQQLPAHVKKQRTKELSALFH SYRPYDHKMGEQQQVLVTEESFDSQYYVAHNKFYEQVLVPKRPEYLGKMVQVEVYECGKH YMKGRPLEEAPLRTAYTTAPLLKGQVSGHTQAGVCEPQCWMPDGMRILAVVLLLSAVLLA LLMEKLL
Uniprot No.

Target Background

Function
This enzyme catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t⁶A), producing 2-methylthio-N6-threonylcarbamoyladenosine (ms²t⁶A) at position 37 in tRNAs that recognize codons beginning with adenine.
Database Links

KEGG: dre:393600

UniGene: Dr.118384

Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Danio rerio Threonylcarbamoyladenosine tRNA methylthiotransferase (cdkal1)?

Danio rerio cdkal1 is an enzyme that catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t(6)A), leading to the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms(2)t(6)A) at position 37 in tRNAs that read codons beginning with adenine. This enzyme belongs to the methylthiotransferase family, specifically the CDKAL1 subfamily, and consists of approximately 250 amino acids . The enzyme plays a critical role in post-translational modification processes that affect tRNA function and subsequently protein synthesis regulation. The zebrafish cdkal1 shares significant homology with human CDKAL1, making it an excellent model for studying both basic tRNA biology and disease-relevant mechanisms. Understanding its structure and function provides insights into fundamental processes of tRNA modification that are conserved across vertebrates.

How does cdkal1 function in zebrafish developmental biology?

Cdkal1 functions as a key regulator of tRNA modification during zebrafish embryonic development. The enzyme's activity contributes to a dynamic reprogramming of tRNA expression and modification that occurs during embryogenesis, particularly around the gastrulation stage . This reprogramming is thought to fine-tune the translational machinery for different developmental stages. The specific ms(2)t(6)A modification catalyzed by cdkal1 affects the efficiency and accuracy of codon recognition during translation, potentially influencing which proteins are synthesized during different developmental phases. The temporal regulation of cdkal1 activity appears to be coordinated with broader changes in the tRNA repertoire, suggesting its integration into developmental gene expression networks. Experimental evidence indicates that the pattern of tRNA modifications changes significantly as embryogenesis progresses, with cdkal1-mediated modifications showing developmental stage-specific patterns.

What protein interaction networks involve cdkal1 in zebrafish?

Cdkal1 in zebrafish operates within a network of functionally related proteins involved in tRNA modification and metabolism. According to protein interaction data, cdkal1 has several predicted functional partners including fto (FTO alpha-ketoglutarate-dependent dioxygenase), trmt10a (tRNA methyltransferase 10A), and trit1 (tRNA dimethylallyltransferase) . These interactions highlight the enzyme's integration into broader tRNA processing pathways. Additionally, cdkal1 shows interactions with urod (Uroporphyrinogen decarboxylase), suggesting potential cross-talk between tRNA modification and other metabolic pathways. Other significant interaction partners include gnpda2 (Glucosamine-6-phosphate isomerase), mansc1 (MANSC domain-containing 1), qpctlb (Glutaminyl-peptide cyclotransferase-like b), ero1b (Endoplasmic reticulum oxidoreductase beta), cdk5 (Cyclin-dependent protein kinase 5), and cdc123 (Cell division cycle protein 123 homolog) . These diverse interactions position cdkal1 at the intersection of tRNA modification, cell cycle regulation, and metabolic processes.

How do cdkal1-mediated tRNA modifications affect translation in zebrafish?

Cdkal1-mediated tRNA modifications, particularly the ms(2)t(6)A modification at position 37 in tRNAs, significantly impact translation processes in zebrafish. This modification occurs in tRNAs that read codons beginning with adenine, affecting a substantial portion of the cellular tRNA pool . The ms(2)t(6)A modification enhances codon-anticodon interactions, improving translational efficiency and accuracy for specific codons. During zebrafish embryonic development, the changing landscape of these modifications correlates with developmental transitions, suggesting that cdkal1 activity helps fine-tune the translational machinery for stage-specific protein synthesis requirements . Research indicates that the tRNA repertoire undergoes a major switch around gastrulation, with cdkal1-modified tRNAs showing distinct patterns before and after this developmental milestone. This suggests that cdkal1 contributes to translational reprogramming during embryogenesis, potentially influencing the expression of developmental regulatory proteins at critical junctures.

What approaches are used to study cdkal1 function in zebrafish models?

Research on cdkal1 in zebrafish employs multiple complementary approaches to elucidate its function. Transcriptomic analyses using specialized RNA sequencing protocols such as tRAM-seq have been optimized to capture the full ensemble of nuclear-encoded and mitochondrial tRNAs, enabling comprehensive profiling of tRNA expression and modification patterns . These methods require careful sample preparation to preserve tRNA modifications, with protocols involving adapter ligation and specialized reverse transcription using thermostable group II intron reverse transcriptase (TGIRT-III). For investigating cdkal1's enzymatic activity, in vitro biochemical assays with recombinant protein are employed to measure methylthiolation of target tRNAs. Developmental studies utilize staged zebrafish embryos collected at precise time points to track changes in cdkal1 expression and activity. Genetic approaches, including morpholino knockdown and CRISPR-Cas9 gene editing, help establish causal relationships between cdkal1 and observed phenotypes. Mass spectrometry techniques are essential for identifying and quantifying specific tRNA modifications catalyzed by cdkal1.

What are optimal protocols for recombinant cdkal1 expression and purification?

Optimal expression of recombinant Danio rerio cdkal1 typically employs bacterial expression systems, with E. coli BL21(DE3) being the preferred host strain for high-yield production. The coding sequence should be codon-optimized for E. coli expression and cloned into vectors containing N-terminal His6 or GST tags to facilitate purification. Expression is optimally induced at lower temperatures (16-18°C) overnight with 0.1-0.5 mM IPTG to enhance protein solubility. For purification, a sequential approach combining affinity chromatography (Ni-NTA or glutathione resin), ion exchange chromatography, and size exclusion chromatography yields the highest purity. Buffer optimization is critical, with typical buffers containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol, and 5 mM β-mercaptoethanol. For functional studies, it's essential to confirm enzyme activity post-purification through methylthiolation assays using synthetic tRNA substrates. The purified enzyme should be stored with glycerol (25-50%) at -80°C to maintain activity for long-term use. Quality control should include SDS-PAGE, Western blotting, and mass spectrometry to verify protein identity and integrity.

How should tRNA substrates be prepared for cdkal1 activity assays?

Preparation of tRNA substrates for cdkal1 activity assays requires specific methodologies to ensure appropriate substrate quality. Either native tRNAs isolated from zebrafish embryos or synthetic tRNAs can serve as substrates. For native tRNA isolation, small RNA extraction protocols should be optimized to preserve tRNA integrity, using TRIzol reagent followed by size selection on denaturing polyacrylamide gels. Synthetic tRNAs can be prepared through in vitro transcription using T7 RNA polymerase with linearized DNA templates containing the tRNA sequence. Crucial substrates include tRNAs that read codons beginning with adenine, as these are the primary targets for cdkal1-mediated methylthiolation . Prior to activity assays, tRNAs should undergo proper folding through heating to 85°C followed by slow cooling in the presence of magnesium. For specific activity measurements, tRNAs containing the N6-threonylcarbamoyladenosine (t(6)A) modification at position 37 must be generated, which may require pre-treatment with other enzymes in the t(6)A synthesis pathway. Substrate quality should be verified through gel electrophoresis, UV spectroscopy, and where possible, mass spectrometry to confirm the presence of necessary precursor modifications.

What sequencing approaches best capture cdkal1-mediated tRNA modifications?

Specialized RNA sequencing approaches are required to accurately detect and quantify cdkal1-mediated tRNA modifications. The tRAM-seq (tRNA Amplification and Modification sequencing) protocol has been optimized specifically for this purpose, allowing comprehensive profiling of tRNA expression and modification patterns . This methodology employs adapter ligation followed by reverse transcription using thermostable group II intron reverse transcriptase (TGIRT-III), which can read through many modifications that would block conventional reverse transcriptases. The protocol includes specific steps: adapter ligation to tRNA 3' ends, reverse transcription with specialized RT primers (p-NNNAGATCGGAAGAGCGTCGTGTAGGGAAAGAGTGTAGATCTCGGTGGTCGC-Spc18-CACTCA-Spc18-TTCAGACGTGTGCTCTTCCGATCTATTGATGGTGCCTACAG), gel purification of cDNA products, and library amplification . For direct detection of ms(2)t(6)A modifications, mass spectrometry-based approaches like LC-MS/MS are essential supplements to sequencing data. Computational analysis pipelines must be specifically designed to identify modification-induced mutations or stops in the sequencing data, with specialized algorithms to detect and quantify modification rates at specific positions in tRNAs.

What controls are essential in cdkal1 knockdown experiments?

In cdkal1 knockdown experiments using zebrafish embryos, several controls are essential to ensure experimental validity. First, multiple technical approaches should be employed, comparing morpholino-based knockdown with CRISPR-Cas9 gene editing to rule out off-target effects. For morpholino experiments, both translation-blocking and splice-blocking morpholinos should be tested, alongside a standard control morpholino. Dose-response curves are necessary to determine optimal morpholino concentrations that achieve effective knockdown while minimizing toxicity. Rescue experiments represent the gold standard control, where co-injection of morpholino-resistant cdkal1 mRNA should reverse observed phenotypes. Knockdown efficiency must be quantified through qRT-PCR (for splice-blocking morpholinos) or Western blotting (for translation-blocking approaches). Control phenotypic analyses should include assessment of general developmental parameters (survival, developmental timing, gross morphology) alongside specific readouts for tRNA modification. Additional controls should include analysis of closely related but distinct tRNA modifications to demonstrate specificity of the effect to cdkal1-dependent pathways. Finally, developmental staging must be precisely controlled, with embryos collected at identical timepoints post-fertilization across experimental groups.

How can mass spectrometry be optimized for detecting cdkal1-specific tRNA modifications?

Mass spectrometry optimization for detecting cdkal1-specific modifications, particularly ms(2)t(6)A, requires several specialized approaches. Sample preparation begins with tRNA isolation using phenol-chloroform extraction followed by size selection through gel electrophoresis or commercial kits optimized for small RNAs. Prior to analysis, tRNAs should undergo enzymatic digestion to nucleosides using a combination of nuclease P1, phosphodiesterase I, and alkaline phosphatase. Liquid chromatography separation is critical, with optimal results achieved using C18 reverse-phase chromatography with gradient elution involving ammonium acetate buffer and acetonitrile. Mass spectrometric detection employs multiple reaction monitoring (MRM) in positive ion mode, targeting the specific mass transition for ms(2)t(6)A (m/z 459→327). Quantification requires synthetic ms(2)t(6)A standards to generate calibration curves, with isotope-labeled internal standards improving accuracy. Analytical validation should include limits of detection/quantification determination, linearity assessment, and precision measurements across multiple technical replicates. For developmental studies, careful standardization of sample collection, processing time, and storage conditions is essential to allow meaningful comparisons between developmental stages. This approach enables precise quantification of cdkal1-mediated modifications throughout zebrafish embryogenesis.

How does cdkal1 activity change during critical periods of zebrafish development?

Cdkal1 activity undergoes dynamic regulation during zebrafish embryonic development, with significant changes in both expression and substrate modification patterns. Research demonstrates that tRNA expression levels and modification profiles show a major transition around the gastrulation stage, suggesting that cdkal1 activity is developmentally regulated . This timing corresponds to a critical period when maternal-to-zygotic transition (MZT) occurs and embryonic genome activation takes place. The enzyme's activity appears to contribute to a broader reprogramming of the tRNA pool during this developmental window, potentially facilitating stage-specific translation requirements. Experimental evidence indicates distinct patterns of ms(2)t(6)A modifications before and after gastrulation, with certain tRNA isodecoders showing developmental stage-specific modification profiles. This temporal regulation likely coordinates with other changes in the translational machinery to ensure appropriate protein synthesis as development progresses. The dynamic nature of cdkal1 activity suggests it plays a role in the developmental control of gene expression at the translational level, contributing to the precision of embryonic patterning and differentiation processes.

What is the relationship between cdkal1 polymorphisms and metabolic dysfunction?

Research on cdkal1 polymorphisms has revealed significant associations with metabolic dysfunction across species. In humans, the rs10946398 polymorphism of the CDKAL1 gene has been linked to increased risk of type 2 diabetes and post-transplant diabetes mellitus (PTDM) . Studies in kidney transplant patients showed that individuals with the CC genotype of CDKAL1 rs10946398 had 2.60 times higher risk of developing PTDM compared to those with AC+AA genotypes . This association was confirmed through multivariate logistic regression analysis, identifying the CC genotype as an independent risk factor for PTDM development. The mechanism appears to involve altered pancreatic β-cell function, as CDKAL1 plays a key role in insulin secretion and β-cell development . In mouse models, deletion of the CDKAL1 gene resulted in reduced insulin secretion after glucose stimulation . While direct studies in zebrafish are more limited, the high conservation of cdkal1 across vertebrates suggests similar mechanisms may operate. The relationship between cdkal1 and metabolism likely involves its role in tRNA modification, which affects translational fidelity for specific proteins involved in glucose homeostasis and insulin signaling pathways.

How do cdkal1-interacting proteins influence tRNA modification patterns?

Cdkal1 functions within a complex network of proteins that collectively regulate tRNA modification and processing. Protein interaction data reveal several functional partners, including fto, trmt10a, and trit1, all of which are involved in RNA modification processes . These interactions suggest coordinated activity among different RNA-modifying enzymes, potentially creating modification patterns through sequential or competitive activities. Fto, an alpha-ketoglutarate-dependent dioxygenase, has been shown to demethylate certain RNA modifications, potentially counterbalancing cdkal1 methylthiolation activity in specific contexts. Trmt10a (tRNA methyltransferase 10A) adds methyl groups to guanosine-9 in tRNAs, while trit1 (tRNA dimethylallyltransferase) catalyzes the transfer of dimethylallyl groups to adenosine at position 37 . These enzymes may work in concert with cdkal1 to establish specific modification landscapes that regulate translation. The interaction with cdk5 (Cyclin-dependent protein kinase 5) suggests potential regulation of cdkal1 activity through phosphorylation, providing a mechanism for dynamic control of its function during development. Understanding these protein-protein interactions is crucial for deciphering how complex tRNA modification patterns are established and maintained throughout zebrafish development.

How does cdkal1 contribute to translational regulation during stress responses?

Cdkal1 likely plays a crucial role in translational regulation during stress responses in zebrafish, though this specific aspect remains under-investigated. The enzyme's function in modifying tRNAs at position 37 with ms(2)t(6)A affects codon-anticodon interactions, potentially allowing for selective translation of specific mRNAs under stress conditions. During developmental transitions, which represent a form of programmed stress, cdkal1-mediated modifications show dynamic changes , suggesting similar mechanisms may operate during environmental or cellular stress responses. Research on human CDKAL1 has shown that its expression and activity respond to endoplasmic reticulum stress, particularly in pancreatic β-cells, influencing insulin production . The zebrafish protein interaction network includes ero1b (Endoplasmic reticulum oxidoreductase beta) , indicating potential involvement in ER stress responses. Additionally, the interaction with cdc123 (Cell division cycle protein 123 homolog) suggests cdkal1 may participate in cell cycle regulation during stress-induced growth arrest. Future studies should investigate how oxidative stress, nutrient deprivation, temperature shock, and other stressors affect cdkal1 expression and activity in zebrafish, and how resulting changes in tRNA modification patterns influence the translational response to these challenges.

What statistical approaches best analyze developmental changes in cdkal1-mediated modifications?

Analysis of developmental changes in cdkal1-mediated modifications requires sophisticated statistical approaches to capture temporal dynamics and biological variation. Time-series analysis methods are particularly appropriate, with mixed-effects models accounting for both fixed effects (developmental stage) and random effects (biological variation between clutches). For tRNA modification data, which often shows non-normal distributions, non-parametric tests like Kruskal-Wallis followed by Dunn's post-hoc test may be more appropriate than parametric alternatives. When analyzing modification rates across multiple tRNA species simultaneously, false discovery rate (FDR) correction using Benjamini-Hochberg procedure is essential to control for multiple comparisons. Principal component analysis (PCA) and hierarchical clustering help visualize global patterns in modification data across developmental stages, identifying major transition points. For integrating modification data with gene expression, canonical correlation analysis can reveal relationships between cdkal1-modified tRNAs and codon usage in developmentally regulated genes. Time-course experiments should include sufficient biological replicates (minimum n=3 per time point) and appropriate power calculations to detect meaningful changes. Reproducibility should be assessed through technical replicates and validation using independent methods where possible. Finally, computational modeling approaches can help predict how observed changes in cdkal1-mediated modifications might impact translation efficiency for specific codons during development.

How should researchers design experiments to study cdkal1 function across developmental stages?

Designing experiments to study cdkal1 function across zebrafish developmental stages requires careful planning to capture dynamic changes. A comprehensive experimental design should include:

Developmental StageHours Post-FertilizationKey ProcessesSampling RequirementsAnalysis Methods
1-cell0-0.75 hpfMaternal controlMinimum 100 embryosRNA-seq, Proteomics
16-cell1.5 hpfPre-MBTMinimum 100 embryosRNA-seq, tRAM-seq
High3.3 hpfMBT, Zygotic genome activationMinimum 50 embryosRNA-seq, tRAM-seq, MS
Shield6 hpfGastrulation initiationMinimum 50 embryosRNA-seq, tRAM-seq, MS, ChIP-seq
Bud10 hpfGastrulation completionMinimum 30 embryosRNA-seq, tRAM-seq, MS
Prim-524 hpfOrganogenesisMinimum 20 embryosRNA-seq, tRAM-seq, MS, Imaging
Long-pec48 hpfAdvanced organogenesisMinimum 15 embryosRNA-seq, tRAM-seq, MS, Imaging

This design allows tracking of cdkal1 expression, localization, and activity at key developmental transitions . For mechanistic studies, cdkal1 knockdown should be performed using stage-specific inducible systems (e.g., photoactivatable morpholinos) or tissue-specific CRISPR approaches. Rescue experiments with wild-type and catalytically inactive cdkal1 help distinguish enzymatic from potential structural functions. Tissue-specific analyses become increasingly important after 24 hpf, with laser-capture microdissection or FACS-based approaches isolating specific cell populations. Complementary approaches including RNA-seq, ribosome profiling, and mass spectrometry for tRNA modifications provide a comprehensive view of cdkal1's impact on the translational landscape. This multifaceted approach enables robust characterization of cdkal1's function across development.

What technical challenges exist in quantifying cdkal1-mediated tRNA modifications?

Quantifying cdkal1-mediated tRNA modifications presents several technical challenges that researchers must address. First, low abundance of specific modified nucleosides like ms(2)t(6)A requires highly sensitive detection methods, typically liquid chromatography-tandem mass spectrometry (LC-MS/MS) with optimized parameters for these modifications . Sample preparation is critical, as tRNAs are prone to degradation, and modifications can be altered during extraction processes. RNA modification analysis also suffers from the absence of standardized protocols across laboratories, making cross-study comparisons difficult. For developmental studies, the limited material available from early zebrafish embryos necessitates protocol optimization for small sample sizes, often requiring pooling of embryos. Another significant challenge is distinguishing cdkal1-specific modifications from similar modifications produced by other enzymes, requiring careful experimental design with appropriate controls. Additionally, the dynamic nature of tRNA modifications during development means that precise staging of embryos is essential, with even small variations in collection timing potentially affecting results. Computational analysis presents further challenges, as many software tools are not optimized for modification analysis, and databases of tRNA modifications remain incomplete. Finally, correlating modification changes with functional outcomes in translation requires sophisticated methodologies combining modification analysis with ribosome profiling and proteomics, creating significant data integration challenges.

How can conflicting data about cdkal1 function be reconciled in research literature?

Reconciling conflicting data about cdkal1 function requires systematic evaluation of methodological differences, biological contexts, and experimental limitations across studies. First, researchers should create a comprehensive comparison table documenting key differences in experimental approaches:

Meta-analysis approaches, including systematic reviews and weighted averaging of effect sizes, can help identify consistent patterns across studies despite methodological differences. Biological factors must be considered, including genetic background differences in zebrafish strains, maternal contribution effects, and environmental variables like temperature that affect development timing . Computational approaches including Bayesian inference can formally incorporate uncertainty from conflicting studies. Direct replication studies addressing specific contradictions, ideally using multiple complementary methods simultaneously, provide the strongest resolution. Finally, community resources like consortia-based studies and standardized protocols would reduce future conflicts by increasing methodological consistency. Transparent reporting of negative results and methodological limitations is essential for proper interpretation of the literature on cdkal1 function.

What emerging technologies will advance cdkal1 research in zebrafish models?

Several emerging technologies show promise for advancing cdkal1 research in zebrafish models. Single-cell RNA sequencing combined with modification detection (scNanoPore) will enable unprecedented resolution of cell-type-specific tRNA modification landscapes during development. CRISPR-based technologies continue to evolve, with base editing and prime editing allowing precise modification of cdkal1 without double-strand breaks, creating subtle mutations that affect specific protein domains while minimizing off-target effects. Spatially-resolved transcriptomics methods like Slide-seq or MERFISH adapted for tRNA detection will map cdkal1 activity across intact embryos, preserving spatial context of modifications. For protein studies, proximity labeling methods (BioID, APEX) will provide comprehensive in vivo interaction maps of cdkal1 in different developmental contexts. Advanced mass spectrometry approaches, including ion mobility spectrometry-mass spectrometry (IMS-MS), are increasing sensitivity for modified nucleoside detection from limited biological material. In vivo biosensors for tRNA modification states could provide real-time visualization of cdkal1 activity in living embryos. Computational advances including deep learning approaches for tRNA modification prediction from sequence data will accelerate hypothesis generation. Finally, automated microfluidic systems for high-throughput zebrafish embryo manipulation and analysis will enable large-scale functional screens of cdkal1 variants and interacting factors. These technologies collectively promise to transform our understanding of cdkal1 biology in developmental contexts.

How do findings from zebrafish cdkal1 research translate to human health?

Zebrafish cdkal1 research provides valuable insights with translational relevance to human health, particularly in understanding metabolic disorders. The high conservation of cdkal1 structure and function between zebrafish and humans makes findings potentially applicable across species . Studies linking cdkal1-mediated tRNA modifications to developmental regulation in zebrafish may inform understanding of early developmental origins of adult disease in humans. The CDKAL1 gene in humans has been implicated in type 2 diabetes risk through genome-wide association studies, with specific polymorphisms like rs10946398 increasing disease susceptibility . Zebrafish research elucidating the molecular mechanisms of cdkal1 function provides potential explanations for how these polymorphisms affect human health. For instance, understanding how cdkal1 activity influences translational regulation during stress may explain how CDKAL1 variants affect pancreatic β-cell function under metabolic stress. The zebrafish model also offers advantages for drug discovery, enabling high-throughput screening of compounds that modulate cdkal1 activity or compensate for its dysfunction. Additionally, the role of cdkal1 in embryonic development suggests potential involvement in developmental disorders beyond metabolic disease. Ultimately, zebrafish studies provide mechanistic insights that complement human genetic studies, potentially identifying new therapeutic targets for CDKAL1-associated conditions.

What is the evidence linking cdkal1 polymorphisms to diabetes risk across species?

Substantial evidence links cdkal1/CDKAL1 polymorphisms to diabetes risk, with data from multiple species supporting this association. In humans, the rs10946398 polymorphism of the CDKAL1 gene has been consistently associated with type 2 diabetes risk across diverse populations . A study in kidney transplant patients demonstrated that individuals with the CC genotype of this polymorphism had 2.60 times higher risk of developing post-transplant diabetes mellitus compared to those with AC+AA genotypes (CC vs. AC+AA OR: 2.60, p=0.040) . This finding was confirmed through multivariate logistic regression analysis, which identified the CC genotype as an independent risk factor for diabetes development . The mechanism appears to involve pancreatic β-cell dysfunction, as CDKAL1 plays a key role in insulin secretion. In mouse models, deletion of the CDKAL1 gene resulted in reduced insulin secretion after glucose stimulation, confirming its importance in β-cell function . While direct studies in zebrafish are more limited, the high conservation of the enzyme across vertebrates suggests similar mechanisms. The molecular basis likely involves cdkal1's role in tRNA modification, which affects translational fidelity for proteins involved in insulin production or secretion. This cross-species evidence strengthens the causal relationship between cdkal1/CDKAL1 function and diabetes risk, making it an important target for translational research.

How might therapeutic strategies targeting cdkal1 be developed and tested?

Development of therapeutic strategies targeting cdkal1 would follow a systematic pathway from basic research through preclinical testing in zebrafish models. Initial approaches would focus on identifying small molecule modulators of cdkal1 activity through high-throughput screening assays using recombinant protein and appropriate substrates. Zebrafish embryos offer an excellent platform for subsequent in vivo testing, allowing rapid assessment of compound efficacy, toxicity, and specificity. Candidate therapeutic strategies could include:

  • Small molecule enhancers of cdkal1 activity to compensate for reduced function due to polymorphisms

  • RNA-based therapies using antisense oligonucleotides to modulate cdkal1 splicing in carriers of specific risk alleles

  • CRISPR-based approaches for precise correction of disease-associated variants

  • Downstream interventions targeting pathways affected by altered cdkal1 function

For diabetes-related applications, testing would include assessment of glucose homeostasis in adult zebrafish using established protocols for glucose tolerance testing and insulin sensitivity. Transgenic zebrafish expressing fluorescent reporters for insulin production could provide visual readouts of β-cell function. Advanced testing would employ zebrafish models carrying human CDKAL1 risk variants, created through CRISPR-mediated homology-directed repair. Successful candidates would progress to mammalian models before clinical translation. Throughout development, attention to delivery methods, off-target effects, and long-term safety would be essential. This pipeline leverages zebrafish advantages of rapid development, optical transparency, and genetic tractability while establishing translational relevance to human disease.

What developmental disorders might involve cdkal1 dysfunction?

Cdkal1 dysfunction may contribute to various developmental disorders beyond its established role in diabetes risk. As a regulator of tRNA modification with dynamic expression during embryogenesis , cdkal1 potentially influences numerous developmental processes through translational regulation. Neurodevelopmental disorders represent prime candidates, as precise translational control is critical for neuronal differentiation and circuit formation. The interaction between cdkal1 and cdk5 (Cyclin-dependent protein kinase 5) , a key regulator of neuronal development, further suggests potential roles in brain development. Disorders affecting organs that undergo significant remodeling during development, such as the heart and kidney, may also involve cdkal1 dysfunction through altered translational programs during morphogenesis. Additionally, given the association of human CDKAL1 variants with metabolic disorders , conditions involving metabolic programming during development may be influenced by cdkal1 activity. While direct evidence linking cdkal1 to specific developmental disorders remains limited, its fundamental role in tRNA modification and the dynamic reprogramming of the tRNA pool during embryogenesis support potential contributions to developmental pathologies. Future studies should investigate cdkal1 expression and function in tissue-specific contexts during development, and explore potential associations between CDKAL1 variants and developmental disorders in human populations.

How do environmental factors influence cdkal1 function and related phenotypes?

Environmental factors likely exert significant influence on cdkal1 function and associated phenotypes through multiple mechanisms. Nutritional status appears particularly important, as studies on human CDKAL1 show interactions between genetic variants and dietary factors in determining diabetes risk . In zebrafish, nutrient availability during development could affect cdkal1 expression or activity, potentially altering tRNA modification patterns and subsequent translational programs. Temperature represents another critical environmental factor for zebrafish, as they are poikilothermic organisms. Temperature changes could affect cdkal1 enzyme kinetics directly and influence developmental timing, potentially desynchronizing cdkal1 activity from stage-specific requirements. Exposure to environmental toxicants might impair cdkal1 function through direct inhibition or oxidative damage to the enzyme or its tRNA substrates. Oxidative stress, which can be induced by various environmental insults, may be particularly relevant given cdkal1's interaction with ero1b (Endoplasmic reticulum oxidoreductase beta) , suggesting potential roles in redox regulation. Maternal effects, including transgenerational epigenetic inheritance, could also influence cdkal1 expression patterns in offspring. For human health relevance, these environmental influences might help explain how CDKAL1 genetic variants interact with lifestyle factors in determining diabetes risk. Future research should explicitly test gene-environment interactions involving cdkal1 in zebrafish models, providing insights into similar interactions in human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.