Recombinant Danio rerio TM2 domain-containing protein 1 (tm2d1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag type, please inform us during your order to prioritize its development.
Synonyms
tm2d1; si:ch211-112f11.3; TM2 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-197
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tm2d1
Target Protein Sequence
NDVDSCDKLHLGQYLCKEPRIDDATQEPETCKDRVAWVECLPAPNISCRLSNGTQFKFSG EEVGFNKTIPCRNVSGYSYKVAVALSLFLGWIGADRFYLGYPALGLLKFCTVGFCGIGSL VDFMLISMQIVGPSDGSDYIVDYYGARLTRLSITNETYRRMQPSP
Uniprot No.

Target Background

Database Links

KEGG: dre:100093710

UniGene: Dr.87537

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and evolutionary conservation of tm2d1 in Danio rerio?

TM2D1 belongs to the TM2 domain-containing protein family, which is highly conserved across metazoans. In zebrafish, as in other organisms, tm2d1 contains:

  • An N-terminal signal sequence

  • A variable extracellular region

  • Two transmembrane domains connected by a short intracellular loop

  • An evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif in the intracellular loop

  • A short C-terminal extracellular tail

The two transmembrane domains and the intracellular loop are highly conserved throughout evolution, while the extracellular region between the signal sequence and first transmembrane domain shows more variation between species . The protein's structural module is related to that of the seven transmembrane domain G protein-coupled receptor superfamily .

What are the main functions of tm2d1 in model organisms?

TM2D1 serves several critical functions:

  • Notch Signaling Regulation: TM2D1 and other TM2D family proteins are involved in the regulation of Notch signaling, particularly at the γ-secretase cleavage step .

  • Beta-Amyloid Peptide Binding: TM2D1 (also known as BBP) functions as a beta-amyloid peptide-binding protein and may mediate cellular vulnerability to beta-amyloid peptide toxicity through G protein-regulated mechanisms .

  • Developmental Processes: In Drosophila, all three TM2D genes (including the TM2D1 ortholog) are essential for proper embryonic development, with knockout resulting in maternal-effect neurogenic defects .

  • Cellular Processes in Cancer: In hepatocellular carcinoma (HCC), TM2D1 is involved in epithelial-mesenchymal transition and contributes to cell proliferation, migration, and invasion .

How is tm2d1 expression regulated in zebrafish tissues?

While the provided search results don't contain zebrafish-specific expression data, we can infer from studies in other organisms that:

  • TM2D1 is likely expressed in neural tissues, given its involvement in Notch signaling and neurogenic processes .

  • Expression patterns may vary during development, with potential maternal contribution similar to that observed in Drosophila .

  • In mammalian systems, TM2D1 shows elevated expression in cancer tissues compared to normal counterparts, suggesting tissue-specific regulation .

Research methodologies to determine zebrafish tm2d1 expression would include:

  • Quantitative PCR for temporal expression analysis

  • In situ hybridization for spatial expression patterns

  • Reporter gene constructs to visualize expression in vivo

How does tm2d1 interact with the Notch signaling pathway in Danio rerio development?

The interaction between tm2d1 and Notch signaling in zebrafish can be understood through comparative analysis with other model organisms. In Drosophila, TM2D proteins function at the γ-secretase cleavage step of Notch activation .

Notch signaling activation occurs through:

  • Binding of Notch receptor to ligands (Delta or Serrate in Drosophila)

  • Cleavage of the Notch extracellular domain

  • γ-secretase-mediated cleavage of the transmembrane domain

  • Release of the Notch intracellular domain (NICD)

  • Translocation of NICD to the nucleus to regulate gene expression

TM2D1 appears to modulate this pathway at the γ-secretase cleavage step. In zebrafish, researchers would need to:

  • Perform epistasis experiments with known Notch pathway components

  • Analyze Notch target gene expression in tm2d1 morphants or mutants

  • Evaluate phenotypic similarities between tm2d1 and Notch pathway mutants

The maternal-effect neurogenic phenotype observed in Drosophila TM2D mutants suggests that zebrafish tm2d1 may play crucial roles in early neural development through Notch-mediated lateral inhibition .

What is the relevance of recombinant Danio rerio tm2d1 for studying neurodegenerative disease models?

Recombinant Danio rerio tm2d1 can serve as a valuable tool for studying neurodegenerative diseases, particularly Alzheimer's disease (AD), based on several lines of evidence:

  • Amyloid-Beta Interaction: TM2D1 functions as a beta-amyloid peptide-binding protein. Recombinant protein can be used to study this interaction in vitro and potentially identify compounds that disrupt this binding .

  • Evolutionary Conservation: Studies have shown that human TM2D3 (a related family member) can functionally replace its Drosophila ortholog, suggesting evolutionary conservation of function. This conservation likely extends to zebrafish tm2d1, making it relevant for human disease modeling .

  • Neurological Functions: TM2D family proteins are involved in neuronal function, with knockout in Drosophila causing shortened lifespan and progressive motor and electrophysiological defects .

  • Disease Relevance: The TM2D family has been genetically linked to AD. Specifically, rare variants in TM2D3 are associated with late-onset AD, and the entire TM2D gene family may be involved in AD pathogenesis .

Zebrafish models offer advantages for neurodegenerative disease research including:

  • Transparent embryos allowing in vivo imaging

  • Genetic tractability

  • High-throughput behavioral analysis

  • Rapid development

How does tm2d1 contribute to epithelial-mesenchymal transition (EMT) in disease models?

Studies in hepatocellular carcinoma have shown that TM2D1 promotes epithelial-mesenchymal transition (EMT) . While not directly demonstrated in zebrafish, this function may be conserved and relevant for both developmental processes and disease models.

Key findings on TM2D1's role in EMT include:

  • Overexpression Effects: TM2D1 overexpression induced HCC cell proliferation, migration, and invasion, which was related to the EMT observed in these cells .

  • Clinical Correlation: High TM2D1 expression predicts unfavorable clinical outcomes in HCC patients and correlates with larger tumor size and microvascular invasion .

  • Expression Pattern: TM2D1 is increasingly expressed in HCC tumors relative to peritumoral tissues .

For zebrafish researchers, recombinant tm2d1 could be used to:

  • Study conserved signaling pathways involved in EMT

  • Develop transgenic models with controlled tm2d1 expression

  • Investigate potential roles in developmental EMT processes

  • Establish cancer models with altered tm2d1 function

The connection between AD-related proteins and cancer warrants further investigation, given epidemiological studies showing an inverse correlation between AD and cancer incidence .

What are the optimal conditions for expression and purification of recombinant Danio rerio tm2d1?

Expressing and purifying recombinant Danio rerio tm2d1 requires attention to several factors:

Expression System Selection:

  • Bacterial systems: May be suitable for cytoplasmic domains but challenging for full-length transmembrane proteins

  • Insect cell systems: Better for full-length tm2d1 with proper folding and post-translational modifications

  • Mammalian expression systems: Optimal for functional studies requiring native-like protein

Considerations for Transmembrane Proteins:

  • Include appropriate detergents during purification (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Consider using fusion tags (His, GST, MBP) positioned at N-terminus (before signal sequence) or after the C-terminal tail

  • Optimize solubilization conditions to maintain protein structure

Purification Strategy:

  • Affinity chromatography using tag-based methods

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for further purification

Quality Control:

  • Western blotting to confirm identity

  • Circular dichroism to verify secondary structure

  • Mass spectrometry for precise mass determination

  • Functional assays (e.g., beta-amyloid peptide binding)

What experimental approaches are most effective for studying tm2d1 function in Danio rerio?

Several complementary approaches can be employed to study tm2d1 function in zebrafish:

Genetic Manipulation Techniques:

  • CRISPR/Cas9 Gene Editing: Generate precise knockout or knock-in models similar to the approach used for Drosophila TM2D genes

  • Morpholino Knockdown: For transient loss-of-function during early development

  • Transgenic Overexpression: Using tissue-specific or inducible promoters

Functional Analysis Methods:

  • Notch Signaling Assessment:

    • Analyze expression of Notch target genes (her, hey family)

    • Evaluate Notch-dependent developmental processes

    • Perform γ-secretase activity assays in the presence of recombinant tm2d1

  • Neurological Function Testing:

    • Behavioral assays (locomotion, learning, memory)

    • Electrophysiological recordings

    • Neuroanatomical analysis

  • Interaction Studies:

    • Co-immunoprecipitation with Notch pathway components

    • GST pulldown assays with recombinant tm2d1

    • Proximity ligation assays in vivo

Developmental Analysis:

  • Time-lapse imaging of neural development

  • Cell lineage tracing in tm2d1 mutants

  • Transcriptomic analysis of affected tissues

How can recombinant tm2d1 be used to screen for potential therapeutic compounds for neurodegenerative diseases?

Recombinant Danio rerio tm2d1 can be employed in several screening approaches to identify therapeutic compounds:

Binding Interaction Assays:

  • Beta-Amyloid Peptide Binding: Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to identify compounds that disrupt tm2d1-Aβ interactions

  • AlphaScreen Assays: For high-throughput detection of protein-protein interaction inhibitors

  • Fluorescence-based Assays: Using labeled peptides or FRET-based approaches

Functional Screening Platforms:

  • Notch Signaling Modulation:

    • Reporter assays measuring Notch-dependent transcription

    • γ-secretase activity assays in the presence of compounds and recombinant tm2d1

  • Cellular Assays:

    • Protection against Aβ-induced toxicity in neuronal cells

    • Effects on EMT in appropriate cell models

  • In vivo Zebrafish Screening:

    • Rescue of tm2d1 mutant phenotypes

    • Effects on neurological function in disease models

    • Behavioral assays in transgenic lines

Target Validation Approaches:

  • Structure-based drug design using recombinant tm2d1

  • Characterization of compound binding sites

  • Medicinal chemistry optimization of hit compounds

Translational Considerations:

  • Comparative analysis with human TM2D1

  • Assessment of compound effects across model organisms

  • Evaluation of specificity against other TM2D family members

How do the functions of TM2D family proteins compare across model organisms?

TM2D family proteins show remarkable functional conservation across species:

OrganismTM2D1 OrthologTM2D2 OrthologTM2D3 OrthologShared FunctionsSpecies-Specific Features
DrosophilaCG10795 (biscotti)CG11103 (amaretto)Almondex (amx)Maternal-effect neurogenic phenotype; Notch signaling modulationTriple knockout resembles single knockouts, suggesting cooperative function
Zebrafishtm2d1tm2d2tm2d3Predicted roles in Notch signaling and neurodevelopmentNot fully characterized in search results
HumansTM2D1 (BBP)TM2D2TM2D3β-amyloid peptide binding; potential roles in neurodegenerationTM2D1: Role in cancer progression; TM2D3: Genetic association with AD

All three TM2D proteins across species share:

  • Similar domain structure with two transmembrane domains

  • Conserved DRF motif in the intracellular loop

  • Involvement in Notch signaling pathways

The fact that triple knockout of all TM2D genes in Drosophila does not worsen the phenotype compared to single knockouts suggests these genes function together in a common pathway or complex .

What are the critical differences between mammalian and zebrafish tm2d1 that researchers should consider?

While the search results don't provide direct comparisons between zebrafish and mammalian tm2d1, researchers should consider several potential differences:

Structural Considerations:

  • Sequence divergence in the extracellular domains, which may affect ligand specificity

  • Potential differences in post-translational modifications

  • Possible alternative splicing variants specific to each species

Functional Aspects:

  • Species-specific interacting partners

  • Differences in expression patterns during development

  • Potential redundancy with other family members

  • Zebrafish-specific requirements during development

Experimental Design Implications:

  • Antibody cross-reactivity may be limited

  • Human disease-associated variants need to be mapped to zebrafish counterparts

  • Environmental factors (temperature, pH) for optimal protein function may differ

  • Zebrafish-specific genetic tools and resources should be considered

When designing experiments using recombinant Danio rerio tm2d1, researchers should validate findings through complementary approaches and consider evolutionary context when extrapolating to human disease models.

What are the major challenges in working with recombinant transmembrane proteins like tm2d1?

Working with transmembrane proteins presents several technical challenges:

Expression and Purification Difficulties:

  • Protein misfolding in heterologous expression systems

  • Aggregation during extraction from membranes

  • Low yield compared to soluble proteins

  • Maintaining native conformation in detergent solutions

Functional Analysis Constraints:

  • Reconstitution in appropriate lipid environments

  • Preserving protein-protein interactions

  • Ensuring proper orientation in artificial membranes

  • Limited structural analysis options

Solutions and Workarounds:

  • Use specialized expression systems (C41/C43 E. coli strains, insect cells)

  • Employ fusion partners that enhance solubility (MBP, SUMO)

  • Optimize detergent screening for extraction and purification

  • Consider nanodiscs or liposomes for functional reconstitution

  • Express soluble domains separately for interaction studies

How can researchers effectively analyze the interaction between recombinant tm2d1 and the Notch signaling pathway?

Analyzing tm2d1-Notch pathway interactions requires multiple complementary approaches:

Biochemical Approaches:

  • Direct Interaction Studies:

    • Co-immunoprecipitation with Notch receptor components

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance to determine binding kinetics

    • Crosslinking mass spectrometry to map interaction interfaces

  • Functional Biochemical Assays:

    • γ-secretase activity assays with recombinant tm2d1

    • In vitro Notch cleavage assays

    • Competition assays with known γ-secretase modulators

Cellular Systems:

  • Reporter Assays:

    • Notch-responsive luciferase reporters with tm2d1 manipulation

    • Split-luciferase complementation for protein-protein interactions

  • Localization Studies:

    • Co-localization analysis of tm2d1 with Notch pathway components

    • Trafficking assays to track Notch receptor processing

    • FRET/BRET approaches for proximity detection in living cells

In Vivo Analysis in Zebrafish:

  • Genetic Epistasis:

    • Double mutant analysis with Notch pathway components

    • Rescue experiments with activated Notch in tm2d1 mutants

  • Pathway Readouts:

    • Expression analysis of Notch target genes in tm2d1 mutants

    • Phenotypic analysis of Notch-dependent developmental processes

The evidence from Drosophila suggests that overexpression of the conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at the γ-secretase cleavage step, which provides a foundation for similar studies in zebrafish .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.