Recombinant Danio rerio TM2 domain-containing protein 2 (tm2d2)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Danio rerio TM2 domain-containing protein 2 (tm2d2) is a protein found in zebrafish (Danio rerio) that contains a TM2 domain . TM2D proteins are evolutionarily conserved in metazoans and are present as three separate genes in sequenced model organism species . TM2D2 is part of a family of proteins that includes TM2D1 and TM2D3, all of which contain a predicted N-terminal signal sequence and two transmembrane domains connected by a short intracellular loop near the C-terminus .

Structure and Features

All TM2D proteins, including TM2D2, have a characteristic structure :

  • A predicted N-terminal signal sequence

  • Two transmembrane domains

  • A short intracellular loop connecting the transmembrane domains, located close to the C-terminus

  • An evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif within the intracellular loop, similar to sequences found in some G-protein coupled receptors

Function

  • Interaction with Amyloid-beta (Aβ): TM2D1, another member of the TM2D family, has been shown to interact with Aβ42, a neurotoxic protein that accumulates in AD patient brains . TM2D1 was initially identified as BBP (beta-amyloid binding protein) through a yeast-two hybrid screen .

  • Modulation of Gamma-Secretase Activity: TM2D genes may function as modulators of gamma-secretase activity, a key molecule in AD pathogenesis that regulates amyloid-beta deposition .

  • Role in Notch Signaling: TM2D proteins are implicated in Notch signaling, a crucial pathway for embryonic development and neuronal function .

Table 1: Involvement of TM2D Genes

GeneFunction
TM2D1May function as a transmembrane receptor that mediates Aβ-toxicity. Interacts with Aβ40 and Aβ42. Involved in phagocytosis. Single knockout in mice is embryonic lethal .
TM2D2Similar biological functions to TM2D1 and TM2D3. Involved in phagocytosis. Single knockout in mice is embryonic lethal .
TM2D3Required for embryonic Notch signaling. Loss causes shortened lifespan and progressive motor and electrophysiological defects. Associated with increased risk of developing Alzheimer's disease (AD). Involved in phagocytosis. Single knockout in mice is embryonic lethal .

Research Findings

Research indicates that TM2D genes, including tm2d2, likely function together via a common mechanism . Studies in fruit flies have shown that knockout of any single TM2D gene (TM2D1, TM2D2, or TM2D3) results in similar defects, and flies with all three TM2D genes knocked out exhibit the same defects as single or double knockout flies . This suggests that these genes operate through a shared pathway .

  • Texas Children’s Hospital and Baylor College of Medicine Study: Researchers found that flies mutant for the TM2D3 gene were short-lived and displayed age-dependent motor and electrophysiological defects, similar to those seen in patients with AD. TM2D1 and TM2D2 knockout flies behaved similarly, suggesting shared biological functions .

  • CRISPR-Based Screen: A large-scale cell-based CRISPR-based screen identified all three TM2D genes as novel regulators of phagocytosis. Individual knockout of TM2D genes in a myeloid cell line was sufficient to cause a similar phagocytic defect .

  • Embryonic Lethality: Preliminary data from the International Mouse Phenotyping Consortium indicates that single knockout of mice of Tm2d1, Tm2d2 and Tm2d3 are all recessive embryonic lethal prior to E18.5 .

Reconstitution

To reconstitute recombinant Danio rerio TM2 domain-containing protein 2 (tm2d2), it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tm2d2; si:dkey-49o11.3; zgc:92201; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-229
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tm2d2
Target Protein Sequence
QNSTEPPGNRVTTSKPVLFSEQPEENVTESGSVIPTETSNHTEQYEYNPPSPVVLCRYLP EEFIFCQDPVDHGGNVSAFQELGYGCVKFGGQVYKDVNHTQVLCTALDGIECAGPREFLR GNEPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILL ITGGLTPSDSSNWCTFY
Uniprot No.

Target Background

Database Links

KEGG: dre:436913

UniGene: Dr.84744

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TM2D2 and what is its evolutionary significance in Danio rerio?

TM2D2 belongs to the TM2 domain-containing (TM2D) protein family, which is highly conserved across metazoans with three separate genes encoding these proteins in each model organism species sequenced to date . In Drosophila, the TM2D2 ortholog is known as amaretto (CG11103), while TM2D1 is biscotti (CG10795) and TM2D3 is almondex . Based on evolutionary conservation patterns, zebrafish TM2D2 likely maintains crucial functional roles similar to its orthologs in other species. The high degree of conservation suggests fundamental biological importance that has been maintained throughout vertebrate evolution . The TM2D protein family exhibits remarkable structural conservation, particularly in the transmembrane domains and intracellular loop regions, suggesting critical functional roles that would be preserved in zebrafish as well .

What is the predicted structure of Danio rerio TM2D2 protein?

Based on comparative analysis with other TM2D family proteins, Danio rerio TM2D2 likely features a conserved structure characteristic of this protein family, including:

  • An N-terminal signal sequence that directs the protein to the secretory pathway

  • Two transmembrane domains positioned toward the C-terminus

  • A short intracellular loop connecting the transmembrane domains

  • An evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif within the intracellular loop, which is found in some G-protein coupled receptors and potentially mediates conformational changes upon ligand binding

  • A divergent extracellular region between the signal sequence and first transmembrane domain

  • A short C-terminal extracellular tail that is evolutionarily conserved but varies among the three TM2D family proteins

The most highly conserved regions across TM2D family members are the transmembrane domains and the intracellular loop, suggesting these are critical for function and likely preserved in zebrafish TM2D2 .

What are the common methods to produce recombinant Danio rerio TM2D2?

Effective production of recombinant Danio rerio TM2D2 typically involves:

  • Expression System Selection: Due to the presence of transmembrane domains, mammalian expression systems (HEK293T or CHO cells) are often preferred over bacterial systems for proper folding and post-translational modifications. Insect cells (Sf9/Sf21) may serve as an alternative for membrane protein expression.

  • Vector Design Considerations:

    • Inclusion of appropriate affinity tags (His6, FLAG, or GST) for purification, preferably at the N-terminus to avoid interference with the C-terminal structure

    • Incorporation of a fluorescent protein tag for localization studies

    • Optional inclusion of a cleavable signal peptide to enhance secretion

  • Purification Approach:

    • Detergent solubilization methods are crucial for extracting membrane-bound TM2D2

    • Common detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin

    • Purification typically employs affinity chromatography followed by size exclusion chromatography

  • Quality Control Assessment:

    • Circular dichroism to verify proper secondary structure formation

    • Thermal shift assays to assess protein stability

    • Western blotting to confirm protein integrity and expected molecular weight

When designing expression constructs, researchers should consider the distinct membrane topology of TM2D2 to ensure the protein adopts its native conformation in the chosen expression system.

How does TM2D2 potentially interact with Notch signaling in zebrafish?

Research in Drosophila has established that all three TM2D family proteins, including TM2D2 (amaretto), are involved in Notch signaling, particularly at the γ-secretase cleavage step . In zebrafish, investigating TM2D2-Notch interactions would involve:

  • Co-immunoprecipitation Studies: Identifying potential physical interactions between TM2D2 and Notch pathway components in zebrafish, particularly the γ-secretase complex members presenilin, nicastrin, APH-1, and PEN-2.

  • Reporter Assays: Utilizing Notch-responsive luciferase reporters in zebrafish cells with TM2D2 overexpression or knockdown to measure pathway activity changes.

  • Domain Mutagenesis Analysis: Systematic mutation of key conserved regions, particularly the DRF motif and transmembrane domains, to identify critical residues for Notch interaction.

  • Notch Target Gene Analysis: Quantifying expression changes in established Notch target genes (her1, her7, deltaC) in TM2D2-manipulated zebrafish embryos using qRT-PCR or in situ hybridization.

  • Developmental Phenotype Assessment: Analyzing phenotypes in TM2D2-depleted embryos that resemble Notch pathway disruption, such as somite formation defects or neurogenic abnormalities.

Studies in Drosophila demonstrated that overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling specifically at the γ-secretase cleavage step . This suggests a similar mechanism might be conserved in zebrafish, warranting investigation of whether zebrafish TM2D2 functions at the same point in the Notch pathway.

What experimental approaches can be used to study potential functional redundancy between TM2D1, TM2D2, and TM2D3 in zebrafish?

Research in Drosophila has revealed that triple knockout of all three TM2D genes produces phenotypes similar to single knockouts, suggesting these genes function together . To investigate potential redundancy in zebrafish:

  • Sequential and Combinatorial Knockouts:

    • Generate single knockouts of each TM2D family gene using CRISPR/Cas9

    • Create double knockouts in all possible combinations

    • Establish triple knockout lines

    • Compare phenotypic severity across these genotypes systematically

  • Rescue Experiments:

    • Test whether overexpression of one family member can rescue defects caused by knockout of another

    • Utilize heat-shock or tissue-specific promoters to control temporal and spatial expression of rescue constructs

  • Domain Swap Analysis:

    • Create chimeric proteins with domains exchanged between TM2D family members

    • Test functionality of these chimeras in knockout backgrounds to identify functionally equivalent regions

  • Transcriptional Compensation Assessment:

    • Analyze whether knockout of one TM2D family member alters expression levels of others

    • Employ qRT-PCR, RNA-seq, or in situ hybridization to quantify potential compensatory transcriptional changes

  • Protein-Protein Interaction Studies:

    • Investigate whether TM2D family proteins physically interact to form complexes

    • Utilize co-immunoprecipitation, proximity ligation assays, or FRET to detect potential interactions

This multi-faceted approach would provide comprehensive insights into the potential functional redundancy between TM2D family members in zebrafish, potentially revealing evolutionary conservation of the cooperative functionality observed in Drosophila .

What is the significance of the DRF motif in zebrafish TM2D2 and how can it be experimentally investigated?

The DRF (aspartate-arginine-phenylalanine) motif within the intracellular loop of TM2D proteins is highly conserved and found in some G-protein coupled receptors where it mediates conformational changes upon ligand binding . To investigate its significance in zebrafish TM2D2:

  • Site-Directed Mutagenesis Strategy:

    • Create point mutations in each residue of the DRF motif (D→A, R→A, F→A)

    • Generate double and triple mutations in combination

    • Introduce alternative amino acids with similar properties to test specificity (D→E, R→K, F→Y)

  • Functional Rescue Assessment:

    • Test the ability of mutated constructs to rescue phenotypes in tm2d2-knockout zebrafish

    • Quantify rescue efficiency through phenotypic scoring systems

  • Structural Analysis:

    • Perform molecular dynamics simulations to predict conformational changes affected by DRF mutations

    • Potentially utilize cryo-EM or X-ray crystallography of recombinant protein fragments containing wild-type or mutant DRF motifs

  • Protein-Protein Interaction Changes:

    • Compare the interactome of wild-type versus DRF-mutant TM2D2 using immunoprecipitation coupled with mass spectrometry

    • Focus particularly on potential interactions with G-proteins or components of the Notch signaling pathway

  • Subcellular Localization Effects:

    • Determine whether DRF mutations alter proper membrane targeting or retention of TM2D2

    • Utilize fluorescently-tagged constructs for live imaging analysis

Given that previous studies have shown the importance of the DRF motif in TM2D1 for mediating Aβ toxicity in cell culture models , investigating whether this motif serves similar functions in zebrafish TM2D2 could provide valuable insights into conserved mechanisms across the TM2D family.

How might TM2D2 be involved in neurodegenerative processes in zebrafish models?

Research has associated TM2D3 with Alzheimer's disease, with rare variants significantly increasing LOAD (Late-Onset Alzheimer's Disease) risk and earlier age-at-onset . Additionally, TM2D1 has been identified as a beta-amyloid binding protein that can interact with Aβ peptides . To investigate potential roles of TM2D2 in neurodegeneration in zebrafish:

  • Aging-Related Studies:

    • Analyze age-dependent expression changes of tm2d2 in zebrafish brain tissues

    • Assess whether tm2d2-knockout zebrafish exhibit accelerated aging phenotypes, as seen with amx (TM2D3) in Drosophila, which showed shortened lifespan and progressive electrophysiological defects

  • Electrophysiological Assessment:

    • Perform detailed electrophysiological recordings of motor neurons in wild-type versus tm2d2-mutant zebrafish at different ages

    • Analyze parameters such as action potential frequency, amplitude, and synaptic transmission efficiency

  • Behavioral Analysis:

    • Conduct quantitative behavioral assays to detect potential motor or cognitive deficits in tm2d2-knockout zebrafish

    • Include assessments at different life stages to identify progressive deterioration

  • Alzheimer's Model Integration:

    • Cross tm2d2-mutant lines with existing zebrafish AD models expressing human Aβ or tau

    • Assess whether tm2d2 mutation exacerbates pathological features of these models

  • Amyloid Interaction Studies:

    • Test direct binding between recombinant zebrafish TM2D2 and Aβ peptides through biochemical assays

    • Conduct co-localization studies in zebrafish brain tissue using appropriate antibodies

  • γ-Secretase Interaction Assessment:

    • Investigate whether TM2D2 physically interacts with or modulates γ-secretase activity in zebrafish

    • Test whether alterations in TM2D2 affect APP processing and Aβ production

Since studies in Drosophila have shown that loss of TM2D3 (almondex) leads to shortened lifespan and age-dependent neurological defects that can be rescued by both fly and human TM2D3 , investigating whether zebrafish TM2D2 shows similar phenotypes would provide valuable comparative insights.

What are the most effective CRISPR-Cas9 knockout strategies for tm2d2 in zebrafish for functional studies?

Effective CRISPR-Cas9 knockout of tm2d2 in zebrafish requires careful consideration of several technical aspects:

  • Target Site Selection:

    • Prioritize early exons to ensure complete loss of function

    • Focus on targeting conserved regions encoding functional domains, particularly transmembrane domains or the DRF motif

    • Use multiple prediction algorithms to select guide RNAs with high on-target and low off-target scores

    • Consider targeting regions that would lead to frameshift mutations affecting all potential splice variants

  • Guide RNA Design Strategy:

    • Implement a dual-guide approach targeting different exons to increase knockout efficiency

    • Consider microhomology-mediated end joining (MMEJ) prediction for more predictable mutation patterns

    • Design guides with optimal GC content (40-60%) and avoid poly-T sequences that can terminate U6 transcription

  • Founder Selection and Breeding Considerations:

    • Screen F0 fish for germline transmission rates using fin-clip genotyping

    • Prioritize mutations causing frameshift over in-frame mutations

    • Establish multiple independent lines with different mutation types for comparative analysis

    • Back-cross for at least 2-3 generations to minimize off-target effects

  • Knockout Validation Methods:

    • Perform mRNA and protein level validation using RT-PCR, qPCR, and Western blotting

    • Conduct RNA-seq to detect potential compensatory transcriptional responses

    • Include rescue experiments with wild-type tm2d2 to confirm phenotype specificity

  • Alternative Approaches:

    • Consider conditional knockout strategies using Cre/loxP systems for tissue-specific or temporally controlled gene inactivation

    • Implement knockdown approaches using morpholinos as complementary strategies, particularly for early developmental studies

This comprehensive approach ensures generation of well-characterized tm2d2 knockout zebrafish lines suitable for detailed functional studies of this protein in development, signaling, and potential roles in neurodegeneration .

How can protein-protein interactions of recombinant Danio rerio TM2D2 be effectively studied?

Investigating protein-protein interactions of TM2D2 requires specialized approaches due to its membrane-associated nature:

  • Co-Immunoprecipitation Optimization:

    • Use mild detergents (digitonin, CHAPS, or DDM) at minimal concentrations to solubilize membrane proteins while preserving interactions

    • Implement crosslinking approaches (DSP, formaldehyde) to stabilize transient interactions

    • Validate results with reciprocal co-IPs using antibodies against different interaction partners

    • Consider native versus denaturing elution conditions based on interaction strength

  • Proximity-Based Labeling Techniques:

    • Implement BioID or TurboID fusion constructs with TM2D2 to identify proximal proteins in living cells

    • Use APEX2 fusions for temporally controlled proximity labeling with subcellular resolution

    • Employ quantitative proteomics with SILAC or TMT labeling to distinguish specific from non-specific interactions

  • Förster Resonance Energy Transfer (FRET) Analysis:

    • Generate fluorescent protein fusions (CFP/YFP or GFP/mCherry pairs) of TM2D2 and potential partners

    • Utilize acceptor photobleaching or fluorescence lifetime imaging microscopy (FLIM) for precise FRET measurements

    • Design truncation mutants to map interaction domains with higher resolution

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to TM2D2 and candidate interactors reconstitute fluorescence upon interaction

    • Particularly useful for visualizing interactions in specific subcellular compartments

    • Can be combined with other fluorescent markers to study complex formation dynamics

  • Surface Plasmon Resonance (SPR) Analysis:

    • Immobilize purified recombinant TM2D2 on sensor chips in the presence of appropriate detergents or lipid nanodiscs

    • Measure direct binding kinetics (kon, koff) and affinity (KD) with potential interactors

    • Particularly valuable for quantitative analysis of interactions with Notch pathway components or Aβ peptides

These methods provide complementary approaches to characterize the TM2D2 interactome, revealing potential functional relationships with Notch signaling components or factors involved in neurodegenerative processes .

What techniques are most effective for studying the localization and trafficking of TM2D2 in zebrafish cells?

Understanding the subcellular localization and trafficking of TM2D2 requires specialized imaging approaches:

  • Fluorescent Protein Fusion Strategies:

    • Generate N- and C-terminal fluorescent protein fusions (GFP, mCherry, or mNeonGreen) to determine which tag position better preserves native localization

    • Consider split-tagging approaches to label internal domains while preserving membrane topology

    • Validate fusion protein functionality through rescue experiments in knockout backgrounds

  • Live Imaging Protocols in Zebrafish:

    • Utilize transgenic lines expressing fluorescent TM2D2 under tissue-specific promoters

    • Implement selective plane illumination microscopy (SPIM) for reduced phototoxicity during long-term imaging

    • Employ photoconvertible fluorophores (Dendra2, mEos) for pulse-chase trafficking studies

  • Organelle Co-localization Analysis:

    • Combine TM2D2 labeling with markers for specific compartments (ER, Golgi, endosomes, lysosomes, plasma membrane)

    • Quantify co-localization using appropriate statistical measures (Pearson's correlation, Manders' coefficients)

    • Implement super-resolution microscopy (STED, STORM) for precise localization at subdiffraction resolution

  • Trafficking Perturbation Experiments:

    • Apply specific inhibitors of trafficking pathways (Brefeldin A, Dynasore, Bafilomycin A1)

    • Combine with temperature-sensitive trafficking blocks for reversible manipulation

    • Analyze resulting changes in TM2D2 distribution to identify key trafficking routes

  • Domain-Specific Trafficking Signals:

    • Generate deletion or point mutation constructs targeting potential trafficking motifs

    • Focus on conserved regions that might contain endocytic or retention signals

    • Quantitatively assess changes in subcellular distribution or surface expression levels

This multi-faceted approach would provide comprehensive insights into TM2D2 localization and trafficking pathways, potentially revealing relationships to function in Notch signaling or neurodegeneration processes .

How can researchers effectively compare TM2D2 function across different model organisms?

Comparative functional analysis of TM2D2 across model organisms requires systematic approaches:

  • Cross-Species Rescue Experiments:

    • Test whether zebrafish TM2D2 can rescue phenotypes in Drosophila amaretto (TM2D2) mutants

    • Conversely, examine if Drosophila or mammalian TM2D2 can rescue zebrafish tm2d2 knockout phenotypes

    • Quantify rescue efficiency to assess functional conservation levels

    • Create domain-swap chimeras to identify species-specific functional regions

  • Conserved Pathway Analysis:

    • Compare effects on Notch signaling across model systems using standardized reporter assays

    • Examine electrophysiological parameters in neuronal systems across species

    • Utilize CRISPR screens in different models to identify conserved genetic interactions

  • Structural Conservation Assessment:

    • Conduct detailed sequence and structural alignment of TM2D2 proteins

    • Generate comparative homology models to visualize conservation in three dimensions

    • Identify species-specific variations that might relate to functional differences

  • Expression Pattern Comparison:

    • Compare developmental and tissue-specific expression profiles across model organisms

    • Utilize orthologous promoter regions to drive reporter expression in different species

    • Identify conserved versus divergent expression regulatory mechanisms

  • Age-Related Phenotype Analysis:

    • Systematically compare age-dependent phenotypes in TM2D2-deficient models

    • Standardize phenotypic measures across species (lifespan reduction percentage, neurophysiological parameters)

    • Implement acceleration or deceleration of aging in different models to test conservation of age-dependent effects

This approach would leverage the advantages of different model systems while establishing the degree of functional conservation of TM2D2 across evolutionary distances, potentially revealing fundamental versus species-specific roles .

How should researchers interpret conflicting data about TM2D2 function between different experimental systems?

When faced with conflicting data about TM2D2 function across different experimental systems:

  • Systematic Variation Analysis:

    • Create a comprehensive table comparing experimental conditions, including:

      • Model organism/cell type differences

      • Expression levels of recombinant proteins

      • Tag positions and types used

      • Assay sensitivity and dynamic range

    • Identify patterns in variables that correlate with divergent results

  • Dose-Response Relationship Examination:

    • Test whether conflicting results might be explained by different expression levels

    • Implement titratable expression systems to create dose-response curves

    • Determine whether effects are linear or threshold-dependent

  • Temporal Dynamics Consideration:

    • Examine whether contradictory findings might reflect different time points in a dynamic process

    • Conduct time-course experiments with high temporal resolution

    • Consider potential feedback mechanisms that might cause time-dependent functional shifts

  • Context-Dependent Function Assessment:

    • Systematically vary the cellular context while keeping other variables constant

    • Consider tissue-specific factors that might influence protein function

    • Test for genetic background effects that might modify phenotypic outcomes

  • Technical Validation Approach:

    • Implement orthogonal techniques to validate key findings

    • Quantify technical variability through appropriate replication

    • Consider the possibility that some assays might detect different functional aspects of the same protein

By systematically addressing these potential sources of variation, researchers can develop more nuanced models of TM2D2 function that integrate seemingly conflicting data into a coherent framework that accounts for context-dependency .

What bioinformatic approaches are most useful for analyzing TM2D2 in the context of Alzheimer's disease models?

Given the association of TM2D3 with Alzheimer's disease and potential similar roles for TM2D2 , several bioinformatic approaches would be valuable:

  • Variant Impact Prediction Pipeline:

    • Analyze potential functional consequences of TM2D2 variants identified in neurodegenerative disease cohorts

    • Implement multiple prediction algorithms (SIFT, PolyPhen, CADD) with ensemble scoring

    • Prioritize variants affecting conserved domains, particularly the DRF motif

    • Consider population-specific variant frequencies in disease versus control populations

  • Gene Co-expression Network Analysis:

    • Construct brain-specific co-expression networks to identify functional modules containing TM2D2

    • Implement WGCNA (Weighted Gene Co-expression Network Analysis) on brain transcriptome data

    • Examine whether TM2D2 clusters with known AD-associated genes

    • Compare network preservation across healthy aging versus disease progression

  • Protein-Protein Interaction Prediction:

    • Use structural modeling to predict potential interactions between TM2D2 and AD-related proteins

    • Implement molecular docking simulations focusing on interactions with Aβ peptides or APP

    • Validate top predictions using experimental approaches

  • Pathway Enrichment Analysis:

    • Perform pathway analysis of genes differentially expressed in TM2D2-deficient models

    • Identify enriched biological processes, focusing on those relevant to neurodegeneration

    • Compare enrichment patterns across different model organisms and experimental conditions

  • Cross-Species Conservation Mapping:

    • Conduct phylogenetic analysis of TM2D family proteins across diverse species

    • Map conservation levels at single-residue resolution to identify critical functional sites

    • Correlate evolutionary conservation with positions of disease-associated variants

These bioinformatic approaches would provide valuable context for experimental studies of TM2D2 in zebrafish models of neurodegeneration, potentially revealing functional relationships with known AD mechanisms and suggesting specific hypotheses for experimental validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.