Recombinant Danio rerio TM2 domain-containing protein 3 (tm2d3)

Shipped with Ice Packs
In Stock

Description

Notch Signaling Regulation

tm2d3 is implicated in modulating Notch signaling, a pathway critical for neurogenesis and development. Studies in Drosophila show that its ortholog (almondex) is required for embryonic Notch signaling, with knockout leading to maternal-effect neurogenic defects . Overexpression of the conserved transmembrane region inhibits Notch signaling at the γ-secretase cleavage step .

Association with Alzheimer’s Disease

Rare variants in TM2D3 (e.g., p.P155L) are linked to late-onset Alzheimer’s disease (LOAD), correlating with earlier age-of-onset and increased risk (OR = 7.45, pMETA = 6.6×10⁻⁹) . While pathogenicity predictions for this variant were inconclusive, functional assays in Drosophila confirmed its deleterious effects .

Cross-Species Conservation

tm2d3 belongs to a conserved gene family (TM2D1, TM2D2, TM2D3) with orthologs in humans, mice, and flies. Key conserved features include:

SpeciesOrthologKey FunctionPhenotype
Danio reriotm2d3Notch signaling, neurogenesisEmbryonic neurogenic defects
DrosophilaalmondexMaternal-effect neurogenesisShortened lifespan, electrophysiological defects
Homo sapiensTM2D3Alzheimer’s risk, Notch regulationLOAD susceptibility

Triple knockout of TM2D genes in Drosophila does not exacerbate phenotypes, indicating functional redundancy .

Research Applications and Experimental Tools

Recombinant tm2d3 is utilized in:

  • ELISA Assays: Quantitative detection using antibodies targeting the His-tag or native epitopes .

  • Functional Studies: Overexpression or knockdown to probe Notch signaling mechanisms .

  • Structural Analysis: Purified protein enables biochemical assays (e.g., γ-secretase inhibition) .

Product Specifications (Cusabio CSB-CF023614DIL):

AttributeDetails
Storage BufferTris-based buffer, 50% glycerol
Shelf Life6 months (liquid) / 12 months (lyophilized) at -20°C/-80°C
Handling NotesAvoid repeated freeze-thaw cycles; store working aliquots at 4°C

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tm2d3; zgc:165591; TM2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-244
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
YLSSPHVGQDPPYLAQQKSVMSSPVALTASSASPVVTDNYVSKCPSGGLCSKLPADCIIC ALHHNCSYGRPHNYTCRPRAGVHCVSDQGERQQNFTLSLLCRFCFQLDASQYRCSNSSDC MTVSCPRRRYNASCEVLEHVHCLGKRVFQKRLFCNWTGGYKWSTALALSITLGGFGADRF YLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI
Uniprot No.

Target Background

Database Links

KEGG: dre:100093711

UniGene: Dr.88

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is tm2d3 and why is it important in zebrafish research?

TM2 domain-containing protein 3 (tm2d3) is a conserved protein belonging to the TM2D family, which consists of three evolutionarily conserved proteins (TM2D1, TM2D2, and TM2D3) found across metazoan species. In zebrafish (Danio rerio), tm2d3 has gained significance due to its orthologous relationship with human TM2D3, a gene implicated in late-onset Alzheimer's disease through exome-wide association studies . The zebrafish model allows researchers to study this protein in a vertebrate system that offers advantages of rapid development, transparency during embryonic stages, and genetic tractability . Zebrafish tm2d3 shares the conserved protein structure found across species, including a predicted N-terminal signal sequence, two transmembrane domains connected by a short intracellular loop containing the evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif .

How do I properly reconstitute and store recombinant Danio rerio tm2d3?

Recombinant tm2d3 protein should be handled with particular attention to maintaining its structural integrity. For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) for long-term storage

Storage recommendations:

  • Lyophilized form: Stable for 12 months at -20°C/-80°C

  • Liquid form: Stable for 6 months at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

Important note: Repeated freezing and thawing significantly diminishes protein quality and should be avoided . For optimal experimental results, make single-use aliquots immediately after reconstitution.

What is the relationship between zebrafish tm2d3 and the other TM2D family proteins?

The zebrafish genome, like other vertebrates, contains orthologs of all three TM2D family proteins. These proteins share conserved structural features including:

FeatureDescriptionConservation Level
Signal sequenceN-terminal regionVaries between family members
Transmembrane domainsTwo domainsHighly conserved
Intracellular loopContains DRF motifHighly conserved
C-terminal tailShort extracellular regionVaries in length between members

Studies in other model organisms suggest that TM2D proteins likely function together, potentially forming a protein complex. Evidence supporting this includes:

  • Physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3 detected in human cells through co-immunoprecipitation mass spectrometry

  • Triple null mutations in Drosophila showing similar phenotypic severity to single nulls, suggesting functional redundancy or cooperation

  • All three TM2D genes being identified in CRISPR-based screens for regulators of phagocytosis

The zebrafish model offers opportunities to explore these relationships in a vertebrate context through gene knockout and protein interaction studies.

How can I use the Tol2 transposon system to generate transgenic zebrafish for tm2d3 studies?

The Tol2 transposon system is an efficient method for generating stable transgenic zebrafish expressing tm2d3 constructs. The procedure involves:

  • Construct design:

    • Clone your tm2d3 sequence downstream of a suitable promoter (tissue-specific or ubiquitous)

    • Include the sequence between minimal Tol2 elements at 5' and 3' flanking sites

    • Consider including a fluorescent tag (e.g., GFP) for visualization

  • Microinjection procedure:

    • Prepare a mixture containing:

      • Tol2 plasmid DNA (20-30 ng/μL)

      • Tol2 transposase mRNA (25-35 ng/μL)

    • Inject 1-2 nL directly into the cell of one-cell stage embryos

    • Ideally inject 100+ embryos for good founder rates

  • Founder identification:

    • Raise injected embryos to adulthood (F0 generation)

    • Screen for germline transmission by outcrossing to wild-type fish

    • Identify F1 carriers through fluorescence or genomic PCR

This technique allows for tissue-specific expression of tm2d3 variants, including the study of disease-associated mutations. For example, you could express human TM2D3 with the P155L Alzheimer's-associated variant alongside wild-type controls to assess functional differences in vivo .

What in situ hybridization techniques are best suited for detecting tm2d3 expression in zebrafish embryos?

In situ hybridization is valuable for determining the spatial and temporal expression patterns of tm2d3 in zebrafish. Multiple techniques are available with different advantages:

  • Classical colorimetric in situ hybridization:

    • Uses alkaline phosphatase or peroxidase-based detection

    • Provides strong signal visible under light microscopy

    • Limited to single gene detection per sample

  • Fluorescent in situ hybridization (FISH):

    • Enables detection of up to three different genes simultaneously

    • Compatible with immunofluorescence for protein co-localization

    • Requires fluorescence microscopy

  • Hybridization chain reaction (HCR) amplification:

    • Allows detection of up to five different transcripts

    • Provides signal amplification for low-abundance transcripts

    • Higher sensitivity than traditional methods

For tm2d3 specifically, creating an antisense RNA probe against the zebrafish tm2d3 transcript allows visualization of its expression pattern. The expression data can be compared with neuronal markers to understand its distribution in the nervous system, which is particularly relevant given the association of TM2D3 with neurodegeneration .

What is the predicted protein structure of zebrafish tm2d3 and how does it compare to human TM2D3?

Zebrafish tm2d3 shares the conserved domain architecture characteristic of TM2D family proteins:

Domain/FeaturePositionFunction
Signal sequenceN-terminalDirects protein to membrane insertion pathway
Extracellular domainBetween signal sequence and first TM domainVariable, potentially involved in interactions with other proteins
Transmembrane domain 1Mid-proteinMembrane anchoring
Intracellular loopBetween TM domainsContains conserved DRF motif, potential signaling function
Transmembrane domain 2Near C-terminusMembrane anchoring
C-terminal tailShort extracellular regionEvolutionarily conserved, function undetermined

The protein shares significant sequence similarity with human TM2D3, particularly in the transmembrane domains and intracellular loop containing the DRF motif. This motif is especially noteworthy as it is found in some G-protein coupled receptors and mediates conformational changes upon ligand binding . The high conservation of these regions suggests functional importance, while the more variable extracellular regions may reflect species-specific adaptations.

How can CRISPR-Cas9 technology be optimized for generating tm2d3 knockout zebrafish models?

Creating precise tm2d3 knockout models requires optimization of the CRISPR-Cas9 system for maximum efficiency and minimal off-target effects:

  • Guide RNA (gRNA) design considerations:

    • Target early exons to ensure functional disruption

    • Select targets with high on-target and low off-target scores

    • Consider targeting conserved domains (TM domains or DRF motif)

    • Design multiple gRNAs to increase chances of successful knockout

  • Delivery protocol:

    • Inject 1-2 nL of a mixture containing:

      • Cas9 mRNA (300 ng/μL) or protein (500 ng/μL)

      • gRNA (50-100 ng/μL)

      • Optional: template for homology-directed repair

    • Inject into one-cell stage embryos at the cell-yolk boundary

  • Validation strategies:

    • T7 endonuclease assay for initial mutation detection

    • Direct sequencing of PCR products spanning target sites

    • Western blot analysis to confirm protein loss

    • Functional assays based on known tm2d3 activities

  • Considerations for TM2D family redundancy:

    • Design strategies for creating double or triple knockouts (tm2d1/tm2d2/tm2d3)

    • Use multiplexed CRISPR to target multiple genes simultaneously

This approach allows investigation of tm2d3 function in vivo and assessment of phenotypes that may relate to neurodegeneration, especially in aging zebrafish, which could mirror aspects of Alzheimer's disease pathology.

What methods can be used to investigate the relationship between tm2d3 and Notch signaling in zebrafish?

Based on studies in Drosophila showing TM2D proteins regulate Notch signaling, several approaches can be used to investigate this relationship in zebrafish:

  • Genetic interaction studies:

    • Create double heterozygous mutants of tm2d3 and known Notch pathway components

    • Look for enhancement or suppression of Notch-related phenotypes

    • Utilize existing Notch reporter lines (e.g., Tg(Tp1:GFP)) to visualize pathway activity

  • Molecular approaches to measure Notch signaling activity:

    • qRT-PCR analysis of Notch target genes (her, hey families)

    • Western blot analysis of cleaved Notch intracellular domain (NICD)

    • Utilize the GFP-based γ-secretase cleavage activity assay adapted for zebrafish

  • Overexpression studies:

    • Express the conserved TM2 domain of tm2d3 to potentially inhibit Notch signaling

    • Create chimeric proteins with the conserved intracellular loop containing the DRF motif

    • Assess effects on Notch-dependent developmental processes

  • Analysis of phenotypes in neural development:

    • Examine neurogenic defects in tm2d3 mutants

    • Perform in situ hybridization for neuronal markers

    • Assess the impact on neural progenitor maintenance and differentiation

These approaches would help determine whether the Notch regulatory function of TM2D proteins observed in Drosophila is conserved in vertebrates, providing insight into potential disease mechanisms.

How can zebrafish models help elucidate the role of tm2d3 in Alzheimer's disease pathogenesis?

Zebrafish offer unique advantages for studying the connection between tm2d3 and Alzheimer's disease mechanisms:

  • Modeling disease-associated variants:

    • Generate knock-in lines with the P155L variant associated with late-onset Alzheimer's disease

    • Create transgenic lines expressing human TM2D3 (wild-type and P155L) for comparative studies

    • Assess functional consequences through behavioral, cellular, and molecular phenotypes

  • Age-dependent phenotypic analysis:

    • Monitor motor function, learning, and memory across lifespan

    • Examine neuronal integrity through electrophysiological recordings

    • Assess synaptic density and function in aging zebrafish brains

  • Integration with other AD-related pathways:

    • Investigate interactions between tm2d3 and amyloid processing machinery

    • Examine potential links to γ-secretase function, which processes both amyloid precursor protein and Notch

    • Study relationships with other zebrafish orthologs of AD-associated genes

  • High-throughput screening applications:

    • Develop phenotypic assays in tm2d3 mutant or transgenic lines

    • Screen for compounds that modify tm2d3-associated phenotypes

    • Identify genetic modifiers through enhancer/suppressor screens

A key advantage of the zebrafish model is the ability to perform longitudinal studies across the lifespan while maintaining relatively high sample numbers compared to mammalian models, allowing detection of subtle age-dependent phenotypes that might mirror aspects of AD progression.

What biochemical approaches can determine if zebrafish tm2d3 forms complexes with other TM2D family proteins?

Building on evidence from human proteomics studies suggesting TM2D proteins form complexes, several approaches can be used to investigate these interactions in zebrafish:

  • Co-immunoprecipitation strategies:

    • Generate antibodies against zebrafish tm2d3, tm2d1, and tm2d2

    • Alternatively, create epitope-tagged versions for expression in vivo

    • Perform pull-downs from brain tissue or transfected cells

    • Analyze by mass spectrometry or Western blotting

  • Proximity labeling approaches:

    • Create fusion proteins with BioID or TurboID enzymatic domains

    • Express in zebrafish through transgenesis

    • Identify proximal proteins through streptavidin pull-down and mass spectrometry

    • Validate interactions through orthogonal methods

  • Fluorescence-based interaction studies:

    • Perform Förster Resonance Energy Transfer (FRET) between fluorescently tagged TM2D proteins

    • Utilize split-GFP complementation assays to detect direct interactions

    • Observe co-localization through high-resolution confocal or super-resolution microscopy

  • Functional validation of complex formation:

    • Generate compound mutants (double and triple knockouts)

    • Perform rescue experiments with single proteins or combinations

    • Assess whether heterologous expression of one family member can rescue defects in another

These approaches would determine whether the interactions observed in human cells are conserved in zebrafish and provide insight into the functional significance of complex formation for neuronal health and function.

What methodological considerations are important when studying age-dependent effects of tm2d3 mutations in zebrafish?

Investigating age-dependent phenotypes in zebrafish tm2d3 mutants requires careful experimental design:

  • Aging cohort establishment and maintenance:

    • Generate sufficient numbers (30+ per genotype) to account for natural mortality

    • Maintain under identical conditions (housing density, feeding, water parameters)

    • Include appropriate controls (wild-type siblings, non-mutant controls)

    • Consider separate male and female cohorts due to sex differences in aging

  • Longitudinal phenotypic assessment:

    • Establish baseline measurements at young adult stage (3-6 months)

    • Perform regular assessments at defined intervals (e.g., every 3-6 months)

    • Include behavioral, physiological, and molecular endpoints

    • Use non-invasive methods where possible to allow continued monitoring

  • Neurological assessment methods:

    • Behavioral testing: Novel tank diving, social interaction, learning/memory tasks

    • Motor function: Swimming performance, startle response

    • Electrophysiology: Field potential recordings from brain slices

    • Neuroimaging: In vivo confocal imaging of fluorescent reporters

  • End-point analyses:

    • Histopathological examination of brain tissue

    • Biochemical assessment of protein aggregation markers

    • Transcriptomic and proteomic profiling

    • Assessment of synaptic structure and neurotransmission

Studies in Drosophila have shown that loss of Almondex (tm2d3 ortholog) causes shortened lifespan with progressive motor and electrophysiological defects , suggesting zebrafish tm2d3 mutants may display similar age-dependent neurological phenotypes that could provide insights into Alzheimer's disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.