Recombinant Danio rerio Torsin-4A (tor4a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tor4a; zgc:110567; Torsin-4A; Torsin family 4 member A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tor4a
Target Protein Sequence
MGEQDPSDRLRGDQLKEPNQNGKGSFSQFSSSVRAMVRIRMKYQAIKKRRMEIASATPQI FTSPRSTSPKVFTFDNLHEPVNSNPASPRKRKKKRKGRVLYPTSSLRAVPTKESSRAKNC LYLLCIIVFLQVYNAIENLDDHVLKYDLEGLEKTLKREVFGQQEVAEGLLGHLQDYLSTY VHNKPLVLSFHGPTGVGKSHVGRLLAQHFRSVVGEELVMQYFVLHHCPTDDDIPVCTKSL ESHISEMVSQGEEEEKIPVFIFDEVEHMPRQLMDTLRELIQPQNSNKYLNAIYILISNLG HEDITKFVLHNSSIAISGRLSLTQELTPWLRNYLQEHHGLFLDAEYLPFMLLEKSHVMDC FIDEMSREGFYPDRSHVERLAEELSYYIVGEREFSHTGCRQVVAKVNLL
Uniprot No.

Target Background

Database Links
Protein Families
ClpA/ClpB family, Torsin subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of Torsin-4A and how does it compare to other Torsin family members?

Torsin-4A (tor4a) belongs to the AAA+ (ATPases Associated with diverse cellular Activities) family of proteins found in zebrafish (Danio rerio). Like other Torsins, it possesses a characteristic C-terminal region essential for its function. The protein contains nucleotide-binding domains with Walker A and Walker B motifs that participate in ATP hydrolysis. The C-terminal alpha-helix is particularly important for protein-protein interactions and ATPase activation, similar to the mechanism observed in other Torsin family members where this region contributes substantially to cofactor binding interfaces .

The structure of Torsin proteins is notable for its fragmentary active site, which requires complementation by binding partners for full activation. This structural arrangement allows for regulated ATPase activity through protein-protein interactions that complete the catalytic core . A key distinction between Torsin family members lies in their specific binding partners and activators, which determine their functional specialization in different cellular contexts.

What expression patterns does Torsin-4A demonstrate during zebrafish development?

Torsin-4A shows a dynamic expression pattern during zebrafish embryogenesis. While specific tor4a expression data is limited, Torsin family proteins exhibit developmentally regulated expression profiles in zebrafish. Expression analysis methods include:

In situ hybridization protocol for Torsin-4A expression analysis:

  • Synthesize digoxygenin-labeled antisense probes for tor4a by subcloning N-terminal fragments into pGEM-T vector

  • Perform in situ hybridization on whole-mount zebrafish embryos at key developmental stages (shield, 10-somite, 24 hpf, 48 hpf)

  • Process embryos following standard protocols and examine under microscopy to document expression patterns

Look for expression in developing tissues, particularly in neural structures and mesoderm-derived tissues. Comparative analysis with other Torsin family members can provide insights into potential functional specialization. Torsin proteins appear during early embryogenesis in zebrafish, suggesting their importance in developmental processes including proper tissue formation and organogenesis .

What are the recommended protocols for cloning and expressing recombinant Danio rerio Torsin-4A?

For successful expression of recombinant Danio rerio Torsin-4A, follow these methodological steps:

  • cDNA isolation and amplification:

    • Extract total RNA from shield-stage zebrafish embryos using Trizol reagent

    • Synthesize first-strand cDNA using oligo(dT) primers

    • Amplify the full-length tor4a using gene-specific primers with appropriate restriction sites

    • Sequence verify the amplified product to confirm correctness

  • Expression vector construction:

    • Subclone the verified tor4a sequence into an appropriate expression vector (e.g., pCS2 for in vitro mRNA synthesis or pET/pGEX for bacterial expression)

    • Include appropriate tags (His, GST, or FLAG) for purification and detection

    • Transform into competent E. coli cells and select transformants

  • Recombinant protein expression:

    • For in vitro studies, synthesize capped mRNA using linearized template

    • For bacterial expression, induce with IPTG at appropriate concentrations (0.1-1.0 mM)

    • Optimize expression conditions (temperature, induction time) to maximize soluble protein yield

    • Extract and purify using affinity chromatography methods appropriate for the fusion tag

This approach ensures high-quality recombinant Torsin-4A production for subsequent functional studies and biochemical characterization.

How can I verify the functional activity of purified recombinant Torsin-4A?

Verifying the functional activity of purified recombinant Torsin-4A requires multiple analytical approaches:

ATPase activity assessment:

  • Set up ATPase assays with purified recombinant Torsin-4A in the presence of potential activating partners

  • Measure ATP hydrolysis using malachite green phosphate detection or coupled enzyme assays

  • Include appropriate controls (heat-inactivated protein, Walker B motif mutants) to validate specificity

  • Compare activity rates with and without potential cofactors to assess activation mechanisms

Torsin proteins typically exhibit low intrinsic ATPase activity that increases substantially in the presence of specific binding partners. The activity enhancement observed upon addition of cofactors provides critical confirmation of proper folding and functional competence. Since Torsins require complementation of their fragmentary active site for full activation, reduced activity in isolation is expected and not indicative of inactive protein .

Binding partner interaction assays:

  • Perform pull-down assays with candidate binding partners identified from homology to known Torsin interactors

  • Use site-specific cross-linking approaches to define interaction interfaces

  • Validate physiologically relevant interactions through co-immunoprecipitation from zebrafish lysates

These complementary approaches provide robust validation of recombinant Torsin-4A functionality beyond simple expression verification.

What are the known binding partners of Torsin-4A in Danio rerio and how can they be investigated?

While specific Torsin-4A binding partners in zebrafish have not been extensively characterized, research on Torsin family proteins provides a framework for investigation. Based on homology with other Torsins, potential binding partners could include LAP1, LULL1, and other proteins involved in nuclear envelope and endoplasmic reticulum functions.

Methodological approach for binding partner identification:

  • Proximity-based labeling:

    • Generate BioID or APEX2 fusion constructs with Torsin-4A

    • Express in zebrafish embryos or cell lines via microinjection

    • Activate labeling and isolate biotinylated proximal proteins

    • Identify using mass spectrometry

  • Yeast two-hybrid screening:

    • Use Torsin-4A as bait against a zebrafish embryonic cDNA library

    • Validate positive interactions using co-immunoprecipitation

    • Confirm physiological relevance through co-localization studies

  • Cross-linking coupled to mass spectrometry:

    • Apply chemical cross-linkers to stabilize transient interactions

    • Perform immunoprecipitation with anti-Torsin-4A antibodies

    • Analyze interacting proteins using LC-MS/MS

    • Identify interaction interfaces through cross-link mapping

Special attention should be paid to proteins that might complement the fragmentary ATPase active site of Torsin-4A, as these interactions are critical for enzyme activation. Proteins containing the arginine finger motif that could insert into the nucleotide-proximal activator interface would be particularly significant .

How does the ATPase activity mechanism of Torsin-4A compare to other Torsins, and what factors influence its activation?

The ATPase activity of Torsin proteins follows a distinctive mechanistic pattern that likely applies to Torsin-4A as well. This mechanism involves complementation of a fragmentary active site by binding partners, resulting in dramatic enhancement of catalytic activity.

Comparative ATPase activation analysis:

Torsin ProteinBasal ActivityActivated ActivityFold ActivationKey Activators
TorsinALowHigh>20×LAP1, LULL1
Torsin-4APredicted lowPredicted highUnknownTo be determined

Key structural factors in Torsin activation:

  • Nucleotide-proximal activator interface:
    The interface between Torsin proteins and their activators near the nucleotide binding site is critical for ATPase stimulation. This region is particularly important for Torsin activation regardless of the stoichiometry of the higher-order assembly .

  • C-terminal alpha-helix:
    The extreme C-terminus of Torsin proteins contributes substantially to the interaction interface with activators. Non-conservative mutations or deletions in this region strongly impair cofactor binding and subsequent ATPase induction .

  • Arginine finger provision:
    Activator proteins likely contribute an arginine residue that participates in ATP hydrolysis, completing the fragmentary active site of Torsin proteins.

To investigate these factors in Torsin-4A:

  • Generate C-terminal deletion mutants and assess cofactor binding and ATPase activity

  • Create site-directed mutations in predicted interface residues

  • Compare activation profiles with different candidate activator proteins

This approach will establish the specific activation mechanism for Torsin-4A and allow comparison with other family members.

What are the most effective methodologies for studying Torsin-4A function in vivo using CRISPR/Cas9 approaches?

CRISPR/Cas9 technology offers powerful approaches for investigating Torsin-4A function in zebrafish. The following methodological framework outlines effective strategies:

Guide RNA design and validation:

  • Design multiple sgRNAs targeting exonic regions of tor4a (preferably early exons)

  • Evaluate sgRNA efficiency using in vitro cleavage assays

  • Select sgRNAs with highest efficiency (>70% cleavage) for in vivo experiments

Microinjection protocol:

  • Prepare injection mix containing: sgRNA (25-50 ng/μl), Cas9 protein (300-500 ng/μl), and phenol red (0.05%)

  • Inject 1-2 nl into one-cell stage zebrafish embryos

  • Include control injections (Cas9 only) to distinguish specific phenotypes from injection artifacts

  • Raise injected embryos to desired developmental stages for analysis

Mutation validation and analysis:

  • Extract genomic DNA from injected embryos or fin clips

  • Amplify the targeted region using PCR

  • Analyze mutations using T7 endonuclease assay, HRMA, or direct sequencing

  • Quantify mosaicism and mutation efficiency

Phenotypic analysis:

  • Examine morphological development at key stages (24 hpf, 48 hpf, 72 hpf)

  • Perform tissue-specific staining for potentially affected structures

  • Conduct in situ hybridization for marker genes (similar to methodology described for other developmental genes)

  • Analyze behavioral outcomes if appropriate

For stable mutant line generation, raise F0 mosaic fish to adulthood and outcross with wild-type to identify germline transmission. Characterize F1 heterozygotes and generate homozygous F2 for complete phenotypic analysis.

How can developmental defects in Torsin-4A-depleted zebrafish be analyzed?

Comprehensive analysis of developmental defects in Torsin-4A-depleted zebrafish requires multiple complementary approaches:

Expression profiling for Torsin-4A-dependent genes:

  • Isolate total RNA from control and Torsin-4A-depleted embryos (morpholino or CRISPR-generated)

  • Perform microarray or RNA-seq analysis to identify differentially expressed genes

  • Validate key candidates using quantitative RT-PCR

  • Analyze affected pathways using gene ontology and pathway enrichment tools

Look for changes in expression of developmental regulators, particularly those involved in mesoderm specification and hematopoiesis, which have been linked to other zebrafish Torsin-related phenotypes. Based on Torsin family protein roles, expression of genes involved in nuclear envelope integrity, endoplasmic reticulum function, and cytoskeletal organization may be affected.

Marker gene analysis through in situ hybridization:

  • Synthesize digoxygenin-labeled antisense probes for key developmental markers

  • Perform whole-mount in situ hybridization on control and Torsin-4A-depleted embryos

  • Analyze expression patterns at multiple developmental stages

Rescue experiments:

  • Synthesize wild-type tor4a mRNA using linearized template and in vitro transcription

  • Co-inject with CRISPR or morpholino reagents targeting endogenous tor4a

  • Assess rescue of morphological and molecular phenotypes

  • Perform domain-specific rescue with mutant constructs to map functional regions

Special attention should be paid to hematopoietic markers (gata1, scl, lmo2, pu.1) based on the known involvement of other factors in zebrafish hematopoiesis, as well as to markers of tissue integrity and cellular architecture.

What approaches can be used to investigate the potential role of Torsin-4A in zebrafish hematopoiesis?

Investigating Torsin-4A's potential role in zebrafish hematopoiesis requires specialized methodologies:

Hematopoietic marker analysis:

  • Perform in situ hybridization for early (scl, lmo2) and lineage-specific (gata1, pu.1) hematopoietic markers in control and Torsin-4A-depleted embryos

  • Quantify expression differences using imaging analysis

  • Assess spatial and temporal alterations in expression patterns

Functional hematopoiesis assays:

  • Perform o-dianisidine staining to detect hemoglobinized cells

  • Conduct flow cytometry on dissociated cells from transgenic zebrafish lines with fluorescently labeled blood lineages

  • Assess circulation and vascular integrity using microangiography

Epistasis analysis with known hematopoietic regulators:

  • Determine the relationship between tor4a and key hematopoietic factors like cdx4

  • Design experiments with combinations of morpholinos or CRISPR targeting both tor4a and partner genes

  • Perform rescue experiments with mRNA injection to establish genetic hierarchies

In zebrafish, commitment of mesoderm to the hematopoietic lineage occurs through transcriptional pathways such as the trf3-mespa-cdx4 pathway identified in previous studies . Investigating whether Torsin-4A interacts with or regulates components of this pathway would provide insights into its potential role in hematopoiesis.

Transplantation assays:

  • Generate chimeric embryos by transplanting cells from Torsin-4A-depleted donors into wild-type hosts

  • Assess the ability of donor cells to contribute to blood lineages

  • Determine cell-autonomous versus non-cell-autonomous requirements

This comprehensive approach will establish whether Torsin-4A plays a direct role in hematopoiesis or if hematopoietic defects are secondary to other developmental abnormalities.

How can site-specific cross-linking approaches be optimized to define Torsin-4A interaction interfaces?

Site-specific cross-linking provides valuable insights into protein-protein interaction interfaces. For Torsin-4A, this approach can be optimized through:

Systematic mutagenesis strategy:

  • Generate a series of single-cysteine Torsin-4A variants by replacing native cysteines with alanine and introducing unique cysteines at positions predicted to be at interfaces

  • Express and purify these variants using the recombinant expression system

  • Validate proper folding through ATPase activity assays

Optimized cross-linking protocol:

  • Incubate purified Torsin-4A variants with potential binding partners

  • Apply thiol-specific cross-linkers (e.g., BMOE, MTS reagents) at controlled concentrations

  • Analyze cross-linked products using SDS-PAGE and western blotting

  • Identify cross-linked residues using mass spectrometry

Focus particularly on residues near the nucleotide-binding site and the C-terminal region, as these areas are critical for Torsin activation based on studies of other family members. The nucleotide-proximal activator interface is especially important for Torsin activation regardless of higher-order assembly stoichiometry .

Cross-linking efficiency depends on optimal buffer conditions (pH, ionic strength) and cross-linker concentration. Preliminary optimization experiments should be conducted with control proteins to establish conditions that maximize specific cross-linking while minimizing non-specific interactions.

What are the recommended controls for validating Torsin-4A knockdown specificity in zebrafish?

Validating the specificity of Torsin-4A knockdown in zebrafish requires multiple control strategies:

Essential controls for morpholino experiments:

  • Use both translation-blocking and splice-blocking morpholinos targeting tor4a

  • Include control morpholinos with similar chemical properties

  • Perform dose-response experiments to identify the minimum effective dose

  • Validate knockdown efficiency at protein level (western blot) and/or mRNA level (RT-PCR)

  • Rescue phenotypes by co-injecting tor4a mRNA lacking the morpholino binding site

Controls for CRISPR/Cas9 experiments:

  • Use multiple guide RNAs targeting different regions of tor4a

  • Include non-targeting guide RNA controls

  • Validate mutations by sequencing

  • Generate and characterize F2 homozygous mutants to confirm phenotypes

  • Perform rescue experiments with wild-type tor4a mRNA

Specificity validation:

  • Assess potential off-target effects using computational prediction tools

  • Examine expression of closely related genes to rule out compensatory effects

  • Perform transcriptome analysis to identify unexpected gene expression changes

  • Include p53 morpholino in control experiments to distinguish specific phenotypes from non-specific toxicity effects

This comprehensive approach to controls ensures that observed phenotypes are specifically attributed to Torsin-4A depletion rather than experimental artifacts or off-target effects.

How can I optimize extraction and analysis of Torsin-4A from zebrafish embryos for biochemical studies?

Optimizing extraction and analysis of Torsin-4A from zebrafish embryos requires specialized protocols:

Enhanced extraction protocol:

  • Collect 50-100 embryos at the desired developmental stage

  • Deyolk embryos in ice-cold Ringer's solution with protease inhibitors

  • Homogenize in specialized extraction buffer (50 mM HEPES pH 7.5, 150 mM NaCl, 1 mM MgCl₂, 1% Triton X-100, 0.1% SDS, 5% glycerol, protease inhibitor cocktail)

  • Sonicate briefly (3×10s pulses) to disrupt nuclear membranes

  • Centrifuge at 16,000×g for 15 minutes at 4°C

  • Collect supernatant for analysis

Fractionation for membrane-associated proteins:

  • Perform differential centrifugation to separate cellular compartments

  • Isolate nuclear envelope and ER fractions (where Torsin proteins typically localize)

  • Extract with increasing detergent concentrations to solubilize membrane-associated proteins

Analysis methods:

  • Western blotting with optimized sample preparation (avoid boiling samples)

  • Blue native PAGE to preserve protein complexes

  • Size exclusion chromatography to analyze oligomeric state

  • ATPase activity assays on partially purified fractions

This approach accounts for the membrane association and complex formation tendencies of Torsin family proteins, improving yield and maintaining native properties for biochemical characterization.

How can comparative analysis between Danio rerio Torsin-4A and human Torsin proteins advance biomedical research?

Comparative analysis between zebrafish Torsin-4A and human Torsin proteins offers valuable insights for translational research:

Evolutionary conservation analysis:

  • Perform detailed sequence alignment of zebrafish Torsin-4A with human Torsin family members

  • Identify conserved domains, especially those involved in ATPase activity and protein interactions

  • Map disease-associated mutations from human Torsins onto the zebrafish Torsin-4A sequence

Functional complementation studies:

  • Express human Torsin proteins in zebrafish Torsin-4A mutants

  • Assess rescue of developmental and cellular phenotypes

  • Identify functionally equivalent domains through chimeric protein approaches

Disease modeling potential:

  • Generate zebrafish models carrying equivalent mutations to human disease-associated variants

  • Characterize phenotypes at molecular, cellular and organismal levels

  • Use these models for small molecule screening and drug discovery

The conservation of Torsin protein function across vertebrates makes zebrafish an excellent model system for studying basic mechanisms of Torsin action and for modeling human diseases associated with Torsin dysfunction. The optical transparency and genetic tractability of zebrafish embryos provide unique advantages for visualizing subcellular dynamics and for large-scale genetic and chemical screening approaches.

What are the latest advanced imaging techniques for analyzing Torsin-4A subcellular localization and dynamics?

Advanced imaging techniques offer powerful approaches for investigating Torsin-4A localization and dynamics:

Super-resolution microscopy approaches:

  • Stimulated Emission Depletion (STED) microscopy for visualizing Torsin-4A localization relative to nuclear envelope and ER structures

  • Photo-Activated Localization Microscopy (PALM) for single-molecule tracking of tagged Torsin-4A

  • Structured Illumination Microscopy (SIM) for improved resolution of Torsin-4A distribution patterns

Live imaging in zebrafish embryos:

  • Generate transgenic lines expressing fluorescently tagged Torsin-4A under native promoter

  • Perform confocal time-lapse imaging to track dynamics during development

  • Use Selective Plane Illumination Microscopy (SPIM) for whole-embryo imaging with reduced phototoxicity

Protein dynamics analysis:

  • Fluorescence Recovery After Photobleaching (FRAP) to measure Torsin-4A mobility

  • Fluorescence Loss In Photobleaching (FLIP) to assess continuity of Torsin-4A compartments

  • Fluorescence Correlation Spectroscopy (FCS) to determine diffusion properties and complex formation

Proximity labeling with temporal control:

  • Implement optogenetic APEX2 systems for spatiotemporally controlled labeling

  • Map Torsin-4A interaction networks in specific subcellular compartments

  • Track changes in interactome during development or stress responses

These advanced imaging approaches provide unprecedented insights into the dynamic behavior of Torsin-4A, revealing its functional roles in specific cellular compartments and developmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.