Recombinant Danio rerio Transmembrane and ubiquitin-like domain-containing protein 1 (tmub1)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1) is a protein that participates in the endoplasmic reticulum-associated protein degradation (ERAD) pathway and functions as a ubiquitin-like protein . TMUB1 has a role in a range of cellular processes, including receptor trafficking . It is known by other names, including Hepatocyte Odd Protein Shuttling (HOPS) .

Gene and Protein Structure

The TMUB1 gene is found at the 4q11 position on chromosome 4 in rats and on chromosome 7 in humans . It consists of 1381 base pairs . The TMUB1 protein includes 245 amino acids, featuring a nuclear export signal (NES) at the amino terminus and a ubiquitin-like (UBL) structure in the 121–175 amino acid region . TMUB1 is a transmembrane protein .

Function

TMUB1 is involved in different cellular functions:

  • Regulation of AMPA receptor recycling TMUB1 facilitates the recycling of AMPA-selective glutamate receptor GRIA2 to the cell surface .

  • Inhibition of cell proliferation TMUB1 has an inhibitory effect on the proliferation of normal hepatocytes . It can inhibit STAT3 function by suppressing the phosphorylation of STAT3 .

  • Role in tumorigenesis TMUB1 participates in inhibiting tumorigenesis through the p14arf-p53 pathway by repairing DNA .

  • Regulation of PD-L1 levels TMUB1 increases PD-L1 levels in cancer cells, promoting immune evasion .

Expression

TMUB1 is expressed in various tissues, including the brain and liver . Its expression is significantly increased in hepatocytes after hepatectomy .

Role in Diseases

TMUB1 is implicated in several diseases, including:

  • Hepatocellular Carcinoma (HCC) TMUB1 expression is positively correlated with STAT1 expression in surgically resected HCC specimens, and TMUB1/STAT1 expression is negatively correlated with HCC pathological malignancy .

  • Colon Cancer High expression of TMUB1 is a negative prognostic factor for colon cancer patients .

  • Breast Cancer High levels of TMUB1 are significantly associated with decreased survival, and CD8+ T cell infiltration in patients’ tumor tissue is negatively correlated with the protein level of TMUB1 .

Interaction

TMUB1 interacts with CAMLG, a protein that modulates intracellular calcium levels . Co-immunoprecipitation experiments have confirmed their interaction in mammalian cells, with partial co-localization observed in the cytoplasmic region .

Prognostic Significance

High TMUB1 expression is associated with poor prognosis in several cancers :

Table 1: Correlation between TMUB1 Expression and Clinicopathological Features

CharacteristicsTotal (N)Odds ratio (OR)P value
T stage (T3&T4 vs. T1&T2)4770.953 (0.606–1.498)0.836
N stage (N1&N2 vs. N0)4781.368 (0.949–1.975)0.094
M stage (M1 vs. M0)4152.082 (1.210–3.675)0.009
Pathologic stage (Stage III&Stage IV vs. Stage I&Stage II)4671.487 (1.029–2.153)0.035
Perineural invasion (YES vs. NO)1810.966 (0.476–1.916)0.921
Lymphatic invasion (YES vs. NO)4341.961 (1.327–2.911)<0.001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
tmub1; zgc:77146; Transmembrane and ubiquitin-like domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmub1
Target Protein Sequence
MALIEGVGDEVTLLFGVVFLVLVLVLAWASTHTVEPPEHLLSPSPGASPSTETDSQEPLP PGNTDSSPGGVRDEDDKSEPGTEAGAAGQSADGSRAGGGDGGLLDDAGLGSDGLRHRESA GPSTHPPESTPSATQPSAEDAASDTHRNMVLRLKFLNDTERTAQVNPQDTIGYIKRTYFA GQEHQVRLIYQGQLLQDDSQTLASLNLADNSVLHCHISQHATRAMPAGARAADQVHVALN VGSLMVPLFVLMLSVLWYFQIQYRQFFTAPATASLVGITIFFSFVAFGVYRR
Uniprot No.

Target Background

Function
This protein may regulate translation during cell cycle progression and contribute to cell proliferation. Its membrane-bound form is involved in sterol-regulated ubiquitination and degradation of HMG-CoA reductase (HMGCR). It may also play a role in centrosome assembly.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm. Nucleus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.