Recombinant Danio rerio Transmembrane protein 11, mitochondrial (tmem11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem11; zgc:110086; Transmembrane protein 11, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem11
Target Protein Sequence
MASLGRRRGVPVNRERGVMAATECYIVHEIYNGENAQEQFEYELEQALEAQYRYIVIEPT RIGDETARWVAVGNCLHKTAVLAGAACLLTPLALPVEYSRYVALPAGALSLACATLYGIS WQFDPCCKYQVEYDSQKLSRLPLHTLTSSTPVVLVRRDDVHRKRLHNTIALAALAYCAKK IYELYAV
Uniprot No.

Target Background

Function

Plays a role in mitochondrial morphogenesis.

Database Links
Protein Families
TMEM11 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the known splice variants of zebrafish tmem11?

Zebrafish tmem11 has two identified splice variants that share a common 3' end but differ at their 5' regions. The longer form, known as tmem11-201, contains an additional 18 amino acids at the N-terminus compared to the shorter tmem11-202 variant. Both forms are expressed throughout early zebrafish development as confirmed by non-quantitative RT-PCR using primers specific to their different 5'UTRs .

What is the predicted membrane topology of zebrafish Tmem11?

Both zebrafish Tmem11 splice variants are predicted to be transmembrane proteins that cross the mitochondrial membrane three times. This topology is similar to the human ortholog, which also contains three transmembrane domains. The protein lacks a canonical nuclear localization sequence, further supporting its primary role as a membrane-bound protein .

Where does zebrafish Tmem11 localize subcellularly?

Contrary to earlier assumptions about TMEM11 being an inner mitochondrial membrane protein, recent biochemical fractionation experiments have demonstrated that zebrafish Tmem11 localizes to the outer mitochondrial membrane (OMM). Both splice variants (201 and 202) tagged with EGFP on their N-terminus showed clear co-localization with mitochondrial markers when expressed in COS7 cells. Importantly, when treated with Proteinase K, both EGFP-Tmem11 proteins were degraded along with the outer membrane marker TOM20, while the inner membrane marker OPA1 remained protected, confirming the outer membrane localization .

How does Tmem11 overexpression affect mitochondrial morphology?

When zebrafish Tmem11 proteins are overexpressed in cell culture (as determined by high signal intensity), mitochondria appear clumped together, suggesting defects in mitochondrial fission or fusion processes. This phenotype is consistent with observations in human cells overexpressing TMEM11, indicating evolutionary conservation of Tmem11's role in regulating mitochondrial dynamics .

What are effective methods to visualize zebrafish Tmem11 localization?

Table 1: Effective Methods for Tmem11 Visualization

MethodApplicationKey ConsiderationsResults
N-terminal EGFP taggingFluorescence microscopyTag both splice variants (201 and 202)Successfully localizes to mitochondria
C-terminal tagging (e.g., Cherry)Fluorescence microscopyMay interfere with protein functionDoes not properly localize to mitochondria
Mitochondrial co-stainingCo-localization studiesUse markers like COX IV and TOM40Confirms mitochondrial localization
Super-resolution SoRa confocal microscopyHigh-resolution localizationCan distinguish submitochondrial locationsReveals precise membrane distribution

For accurate visualization of zebrafish Tmem11, researchers should use N-terminal EGFP tagging rather than C-terminal tagging, which appears to interfere with proper mitochondrial localization. Co-staining with established mitochondrial markers like COX IV and TOM40 is recommended to confirm localization. For human TMEM11, super-resolution SoRa confocal microscopy has been effectively employed to precisely determine submitochondrial localization patterns .

How can researchers determine whether Tmem11 is an outer or inner mitochondrial membrane protein?

To determine the submitochondrial localization of Tmem11, researchers should employ biochemical fractionation followed by protease protection assays. This approach involves:

  • Isolating intact mitochondria through differential centrifugation

  • Treating isolated mitochondria with Proteinase K before and after osmotic rupture of the outer membrane

  • Analyzing protein degradation patterns by Western blotting

  • Comparing degradation patterns with known outer membrane (e.g., TOM20) and inner membrane (e.g., MIC60 or OPA1) markers

Using this methodology, both zebrafish Tmem11 variants were shown to be degraded by Proteinase K treatment of intact mitochondria, similar to the outer membrane marker TOM20, while the inner membrane marker OPA1 remained protected. This confirms that zebrafish Tmem11 is an outer mitochondrial membrane protein .

What approaches are recommended for studying Tmem11 protein interactions?

Table 2: Methods for Studying Tmem11 Protein Interactions

MethodAdvantagesLimitationsKey Findings
Yeast two-hybridDetects direct protein interactionsHeterologous system may cause artifactsIdentified interaction between Tmem11-201 and Bnip3
Immunoprecipitation with GFP-tagged Tmem11Captures physiological complexesOverexpression may alter interaction stoichiometryIdentified MICOS complex subunits and BNIP3/BNIP3L as interactors
Mass spectrometry following IPUnbiased identification of interaction partnersMay detect indirect interactionsIdentified BNIP3L as top scorer interactor
2D BN-PAGE gelsPreserves native protein complexesLimited to stable interactionsRevealed TMEM11 assembles with MICOS/MIB complexes

For studying zebrafish Tmem11 interactions, researchers have successfully used yeast two-hybrid approaches, showing that the longer Tmem11-201 variant interacts with zebrafish Bnip3. For human TMEM11, immunoprecipitation of GFP-tagged TMEM11 followed by mass spectrometry identified multiple interaction partners, with BNIP3L (NIX) as the top scoring interactor, followed by BNIP3, VDAC1, and VDAC2 .

How does Tmem11 contribute to mitochondrial morphology regulation?

TMEM11 plays a critical role in maintaining normal mitochondrial morphology across species. In human cells, TMEM11 depletion using CRISPRi leads to enlarged and/or bulbous mitochondria compared to the narrow tubular morphology in control cells. Electron microscopy reveals that these enlarged mitochondria exhibit curved and/or highly elongated cristae membranes that frequently span the width of the enlarged organelles .

Similar morphological defects are observed in Drosophila PMI (TMEM11 homolog) mutants, where mitochondria are enlarged with elongated and curved cristae membranes. These consistent phenotypes across species suggest that TMEM11's role in mitochondrial morphology regulation is evolutionarily conserved .

The mechanism behind TMEM11's morphological regulation likely involves its interactions with mitophagy receptors BNIP3 and BNIP3L, as well as potential associations with the MICOS complex, which is critical for cristae organization. Interestingly, while a small portion of TMEM11 associates with the MICOS/MIB complex, depleting TMEM11 does not affect the stability of MICOS subunits, suggesting it plays a regulatory rather than structural role in this context .

What is the relationship between Tmem11 and the mitochondrial contact site and cristae organizing system (MICOS) complex?

While TMEM11 was initially thought to be primarily associated with the MICOS complex based on its role in cristae organization, recent evidence has revealed a more nuanced relationship:

  • A small portion of TMEM11 can stably associate with assembled MICOS/MIB complexes, as demonstrated by 2D BN-PAGE gel analysis

  • Super-resolution microscopy shows that while MICOS subunit MIC60 concentrates at discrete focal structures (cristae junctions), TMEM11 appears more uniformly distributed along the mitochondrial membrane

  • TMEM11 occasionally localizes to discrete focal structures that don't co-localize with MIC60, suggesting an independent functional role

  • Unlike core MICOS subunits, TMEM11 protein levels remain stable when MIC60 is depleted

  • Depletion of TMEM11 does not affect the stability of any MICOS subunits

These findings suggest that while TMEM11 can interact with the MICOS complex, its primary function appears to be distinct from MICOS's role in cristae organization. Instead, TMEM11 likely functions primarily through its interactions with outer membrane proteins, particularly BNIP3 and BNIP3L .

How does Tmem11 regulate mitophagy through BNIP3/BNIP3L interactions?

TMEM11 has been identified as a novel negative regulator of the mitophagy receptors BNIP3 and BNIP3L. Proteomic analysis identified these proteins as top interactors of TMEM11, with BNIP3L being the highest scoring. This interaction occurs at the outer mitochondrial membrane where TMEM11 is now known to localize .

The functional significance of this interaction is evidenced by the finding that loss of TMEM11 sensitizes cells to both basal and hypoxic mitophagy mediated by BNIP3/BNIP3L. This suggests that TMEM11 normally functions to restrain or regulate BNIP3/BNIP3L-mediated mitophagy, potentially providing a mechanism for fine-tuning mitochondrial quality control .

How do we reconcile conflicting reports about Tmem11 subcellular localization?

Table 3: Methodological Comparison for Tmem11 Localization Studies

StudyModel SystemMethodologyLocalization FindingLimitations
Rival et al. (2011)DrosophilaPredictive algorithms, mutant phenotypesInner membraneLimited biochemical validation
Gok et al. (2023)Human cellsSuper-resolution microscopy, protease protection, biochemical fractionationOuter membraneMore direct experimental evidence
Current zebrafish studiesZebrafish/COS7 cellsFluorescent tagging, biochemical fractionation, protease protection assaysOuter membraneConsistent with recent human data

The more recent studies employed multiple complementary techniques specifically designed to distinguish between inner and outer membrane localization, including protease protection assays and biochemical fractionation. These methodologies provide more direct experimental evidence than the earlier studies, which relied more heavily on computational predictions and phenotypic analyses .

What explains the differential functions of Tmem11 across different model systems?

While TMEM11's role in mitochondrial morphology appears conserved across species, there are some reported functional differences:

  • In mouse cardiomyocytes, TMEM11 has been reported to localize to the nucleus and cytoplasm in addition to mitochondria

  • In the mouse cardiac system, TMEM11 was proposed to regulate the transcription factor ATF5 rather than affecting mitochondrial membrane potential, apoptosis, or mitophagy

  • In human cells and likely zebrafish, TMEM11 primarily functions as a regulator of BNIP3/BNIP3L-mediated mitophagy

These apparent contradictions might be explained by:

  • Tissue-specific differences in TMEM11 function and localization

  • Species-specific evolutionary adaptations

  • Methodological differences in experimental approaches

  • Potential unrecognized splice variants with different functions

  • Context-dependent protein interactions that vary by cell type or physiological condition

Further comparative studies across tissues and species will be needed to fully reconcile these differences and establish a unified understanding of TMEM11 function .

How might the two zebrafish Tmem11 splice variants differ functionally?

The two zebrafish tmem11 splice variants (201 and 202) differ by 18 amino acids at the N-terminus, with 201 being the longer form. While both variants localize to the outer mitochondrial membrane and cause similar mitochondrial morphology changes when overexpressed, the yeast two-hybrid data suggests a potential functional difference: only Tmem11-201 showed interaction with zebrafish Bnip3 in this system .

This observation raises several research questions:

  • Does the N-terminal extension in Tmem11-201 confer specific binding properties in vivo?

  • Are the two splice variants differentially expressed in various tissues or developmental stages?

  • Do they respond differently to cellular stresses or mitochondrial dysfunction?

  • Could they have distinct functions in mitophagy regulation?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.