Recombinant Danio rerio Transmembrane protein 116 (tmem116)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem116; si:ch211-157p22.10; Transmembrane protein 116
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem116
Target Protein Sequence
MDIFGENKTQMNTTTPTENWTSVYSIVRWIQMTMAVLSILGAGSIILYAAFQRLVKKPEV LPLFLLSLTDLLLALSWLCGGLLFTQSCNSYATCYNLHIVEQTLYMASFFYTLHYVWVLY TGLNGKYHRRLNGFPAEAARTRNCRCLGPVLSCLLPLLLTAPVFVAGNVFQCYTNFTQPY RCLLMHTGAVYLTSSASPELTACSIIQEYCMAIFLGTFLITIVGMSIFMGKARSLYKRVV TSQGFFGGSHWTTLRLLERRMVLYPSAFFFCWGPALLLATMMLVKPDVIEGKMGVALYIL QAFTSASQGLLNCLVYGWTQKHFRSLSSSTVRDANTQTPLLRSQKPNYAALHSAASLTNF V
Uniprot No.

Target Background

Database Links

KEGG: dre:100003849

UniGene: Dr.87038

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Danio rerio Transmembrane protein 116?

Danio rerio Transmembrane protein 116 (tmem116) is a full-length protein consisting of 361 amino acids. The amino acid sequence is: MDIFGENKTQMNTTTPTENWTSVYSIVRWIQMTMAVLSILGAGSIILYAAFQRLVKKPEVLPLFLLSLTDLLLALSWLCGGLLFTQSCNSYATCYNLHIVEQTLYMASFFYTLHYVWVLYTGLNGKYHRRLNGFPAEAARTRNCRCLGPVLSCLLPLLLTAPVFVAGNVFQCYTNFTQPYRCLLMHTGAVYLTSSASPELTACSIIQEYCMAIFLGTFLITIVGMSIFMGKARSLYKRVVTSQGFFGGSHWTTLRLLERRMVLYPSAFFFCWGPALLLATMMLVKPDVIEGKMGVALYILQAFTSASQGLLNCLVYGWTQKHFRSLSSSTVRDANTQTPLLRSQKPNYAALHSAASLTNFV . The protein contains multiple transmembrane domains characteristic of integral membrane proteins. When expressed recombinantly, it is commonly fused with an N-terminal His tag to facilitate purification and detection in experimental systems.

What are the currently identified functional domains of tmem116 in zebrafish?

Based on structural analysis, tmem116 contains several hydrophobic regions that form transmembrane domains, interspersed with hydrophilic segments that likely project into either the cytoplasm or extracellular space. While specific functional domains have not been completely characterized, sequence analysis suggests potential sites for post-translational modifications and protein-protein interactions. The protein contains regions that may be involved in signal transduction pathways, particularly those associated with cellular homeostasis and growth regulation . Researchers should note that functional domain characterization is an evolving area, and experimental validation using techniques such as site-directed mutagenesis and domain deletion analysis is recommended for conclusive domain identification.

How is tmem116 typically expressed and purified for research applications?

For research applications, Recombinant Danio rerio Transmembrane protein 116 is commonly expressed in E. coli expression systems with an N-terminal His tag . The expression process typically involves transformation of the expression vector containing the tmem116 coding sequence into a compatible E. coli strain, followed by induction of protein expression (commonly using IPTG for T7-based expression systems). After expression, the protein is purified using affinity chromatography, leveraging the His tag for selective binding to nickel or cobalt resins. The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . The final product is often supplied as a lyophilized powder, which requires proper reconstitution before experimental use.

What experimental approaches are most effective for studying tmem116 function in zebrafish models?

When investigating tmem116 function in zebrafish models, researchers should consider multiple complementary approaches. For in vivo studies, morpholino-based knockdown and CRISPR-Cas9 genome editing have proven effective for generating loss-of-function models. For protein localization studies, fluorescently tagged tmem116 constructs can be expressed in zebrafish embryos, allowing for real-time visualization of protein trafficking and localization using confocal microscopy. For biochemical interactions, co-immunoprecipitation experiments using the His-tagged recombinant protein can help identify binding partners. Additionally, researchers may consider zebrafish-derived cell lines for in vitro studies of protein function, particularly when investigating cellular signaling pathways. Each approach has specific advantages and limitations that should be considered when designing experimental protocols.

What are the challenges in studying protein-protein interactions involving tmem116, and how can they be addressed?

Studying protein-protein interactions for transmembrane proteins like tmem116 presents several technical challenges. The hydrophobic nature of transmembrane domains can lead to non-specific interactions and protein aggregation during traditional pull-down assays. To address these challenges, researchers should consider:

  • Membrane-mimetic environments: Using detergents or lipid nanodiscs to maintain the native conformation of tmem116 during interaction studies

  • Proximity-based labeling: Techniques such as BioID or APEX2 can identify transient or weak interactors in cellular contexts

  • Split-reporter assays: Methods like split-GFP or BRET can detect interactions in live cells while preserving membrane topology

  • Crosslinking approaches: Chemical crosslinking followed by mass spectrometry can capture transient interactions

Additionally, researchers should validate interactions using multiple orthogonal techniques and appropriate controls to distinguish specific interactions from background binding.

What are the optimal storage and handling conditions for recombinant tmem116 protein?

The optimal storage and handling conditions for recombinant tmem116 protein are critical for maintaining its structural integrity and functional activity. Upon receipt, the lyophilized protein should be stored at -20°C to -80°C, with aliquoting recommended for multiple use scenarios to avoid repeated freeze-thaw cycles . Working aliquots can be maintained at 4°C for up to one week . For reconstitution, the protein should be centrifuged briefly prior to opening to ensure all material is at the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, the addition of 5-50% glycerol (final concentration) is recommended, with 50% being the standard concentration used by suppliers . This glycerol addition helps prevent freeze damage during storage at -20°C or -80°C.

What purification strategies yield the highest activity for recombinant tmem116?

The purification of recombinant tmem116 with optimal activity requires careful consideration of several factors throughout the process. While the protein is typically expressed with an N-terminal His tag to facilitate purification , the following strategies can enhance activity retention:

  • Temperature control: Maintaining low temperatures (4°C) throughout the purification process helps minimize protein denaturation

  • Buffer optimization: Using buffers that mimic physiological conditions (pH 7.4-8.0) with appropriate ionic strength

  • Detergent selection: For membrane proteins like tmem116, the choice of detergent is critical - mild non-ionic detergents like DDM or LMNG often preserve activity better than harsh ionic detergents

  • Protease inhibitors: Including a cocktail of protease inhibitors throughout purification prevents degradation

  • Reducing agents: Addition of DTT or β-mercaptoethanol can prevent oxidation of cysteine residues

The purified protein should be validated for activity using functional assays appropriate to the experimental objectives before proceeding with complex experiments.

What methodological approaches are most effective for studying tmem116 in cellular contexts?

When investigating tmem116 in cellular contexts, multiple methodological approaches can provide complementary insights:

ApproachApplicationAdvantagesLimitations
ImmunofluorescenceLocalization studiesVisualizes native protein in fixed cellsDepends on antibody specificity
Live-cell imagingDynamic localizationCaptures real-time traffickingRequires fluorescent tagging
RNAi knockdownLoss-of-functionRelatively simple implementationPotential off-target effects
CRISPR-Cas9Gene editingComplete knockout possibleComplex clone screening
OverexpressionGain-of-functionStraightforward implementationNon-physiological levels

For cellular studies, it's important to validate findings using multiple cell types and complementary techniques. Additionally, researchers should consider the impact of tags (such as the His tag in recombinant tmem116) on protein localization and function, potentially validating key findings with untagged constructs when possible.

How can researchers distinguish between specific and non-specific effects in tmem116 functional studies?

Distinguishing between specific and non-specific effects in tmem116 functional studies requires rigorous experimental design and appropriate controls. Researchers should implement:

  • Multiple knockdown/knockout strategies: Using different siRNAs, shRNAs, or CRISPR-Cas9 guide RNAs targeting different regions of the tmem116 sequence helps confirm phenotype specificity

  • Rescue experiments: Re-expressing tmem116 in knockout/knockdown models should reverse the observed phenotypes if they are specific

  • Dose-response relationships: For interaction studies, demonstrating concentration-dependent effects supports specificity

  • Negative controls: Including studies with structurally similar but functionally distinct proteins helps identify non-specific effects

  • Complementary techniques: Confirming findings using multiple methodological approaches strengthens confidence in specificity

Additionally, researchers should be cautious about potential artifacts arising from protein overexpression or tag interference, validating key findings with endogenous protein whenever possible.

What are the common pitfalls in interpreting transmembrane protein interaction data, and how can they be avoided?

Interpreting transmembrane protein interaction data presents several challenges that researchers should consider when working with tmem116:

  • Detergent-induced artifacts: Detergents used to solubilize membrane proteins can disrupt native interactions or induce non-physiological ones. Using multiple detergent types and concentrations can help identify consistent interactions.

  • Overexpression effects: High protein levels can drive non-physiological interactions. Validation with endogenous proteins or controlled expression systems is recommended.

  • Tag interference: Tags like the His tag on recombinant tmem116 may affect interaction interfaces. Comparing N- and C-terminally tagged versions can identify potential tag effects.

  • Indirect interactions: Co-purification may reflect indirect interactions within larger complexes rather than direct binding. Techniques like crosslinking mass spectrometry can help distinguish these scenarios.

  • Cellular context dependence: Interactions may be cell-type specific or condition-dependent. Testing in multiple cellular contexts strengthens confidence in biological relevance.

To avoid these pitfalls, researchers should employ orthogonal validation techniques and carefully design controls that account for the specific challenges of membrane protein biochemistry.

How should researchers approach contradictory data when studying tmem116 function across different model systems?

When encountering contradictory data across different model systems in tmem116 research, researchers should:

  • Evaluate methodological differences: Variations in experimental conditions, protein expression levels, or cell types may explain discrepancies

  • Consider species-specific differences: Function may vary between human and zebrafish orthologs despite sequence similarity

  • Examine cellular context: The protein microenvironment, including lipid composition and interacting partners, may differ between systems

  • Assess protein modifications: Post-translational modifications may vary across expression systems, affecting function

  • Analyze isoform expression: Different splice variants may predominate in different systems

Rather than dismissing contradictory findings, researchers should design experiments that directly test hypotheses explaining the contradictions. This might include side-by-side comparisons under identical conditions or hybrid approaches that combine elements from different systems. Ultimately, integrating findings across multiple models often provides the most comprehensive understanding of protein function.

How can tmem116 research contribute to understanding cancer biology and potential therapeutic approaches?

Transmembrane protein 116 research has emerging implications for cancer biology, particularly in understanding cellular homeostasis and growth regulation mechanisms that may be dysregulated in tumorigenesis . Studies with TMEM116 knockout cell lines reveal potential roles in cancer cell proliferation, migration, and apoptosis pathways . Researchers investigating tmem116 in cancer contexts should consider:

  • Comparative expression analysis between normal and malignant tissues

  • Correlation of expression levels with clinical outcomes

  • Pathway analysis to identify signaling networks influenced by tmem116

  • Drug response assays in tmem116 knockout versus wild-type backgrounds

The zebrafish model provides a valuable in vivo system for studying oncogenic processes, with the availability of recombinant Danio rerio tmem116 protein facilitating mechanistic studies. Future research may explore tmem116 as a potential biomarker for cancer detection or progression monitoring, and possibly as a therapeutic target .

What emerging technologies are most promising for elucidating tmem116 function in development and disease?

Several emerging technologies show promise for advancing our understanding of tmem116 function:

  • Cryo-electron microscopy: Enabling high-resolution structural analysis of membrane proteins in near-native states

  • Single-cell transcriptomics: Revealing cell-type specific expression patterns during development

  • Optogenetics: Allowing temporal control of tmem116 function in specific cellular contexts

  • Genome-wide CRISPR screens: Identifying genetic interactions and pathway connections

  • Organoid models: Providing three-dimensional tissue contexts for functional studies

These technologies can be applied to zebrafish models to leverage the experimental advantages of this system, including optical transparency during development and genetic tractability. Integration of data across these platforms will likely provide a more complete understanding of tmem116's roles in both normal physiology and disease states.

How can researchers effectively design experiments to investigate tmem116's potential roles in cellular signaling pathways?

Designing experiments to investigate tmem116's roles in cellular signaling requires a systematic approach:

  • Pathway identification: Begin with broad pathway analysis using phosphoproteomics or transcriptional profiling in tmem116 knockout versus wild-type contexts

  • Temporal dynamics: Employ time-course experiments to distinguish direct versus secondary effects

  • Stimulus-response studies: Examine how tmem116 absence affects cellular responses to relevant stimuli

  • Domain-function analysis: Create truncation or point mutation constructs to map functional regions

  • Interactome mapping: Identify binding partners under different cellular conditions

When designing these experiments, researchers should consider both gain-of-function and loss-of-function approaches, as well as acute versus chronic manipulations. The recombinant Danio rerio tmem116 protein can serve as both a research tool and control in these studies . Additionally, comparative studies between zebrafish and human systems can highlight evolutionarily conserved signaling roles that may have particular biological significance.

What are the most promising future research directions for tmem116 in zebrafish models?

Based on current knowledge and available tools, several research directions appear particularly promising for advancing understanding of tmem116 function in zebrafish models. Developmental studies examining tmem116 expression patterns throughout embryogenesis may reveal stage-specific roles. Functional genomics approaches using CRISPR-Cas9 to generate zebrafish tmem116 mutants could uncover phenotypes relevant to human disease. Proteomics studies identifying the tmem116 interactome in different cellular contexts would help place this protein within relevant signaling networks. The availability of recombinant Danio rerio Transmembrane protein 116 facilitates biochemical and structural studies that complement in vivo approaches . Additionally, comparative studies between zebrafish and human tmem116 may highlight evolutionarily conserved functions of particular biological significance.

What methodological recommendations should researchers consider when beginning work with tmem116?

Researchers beginning work with tmem116 should consider several methodological recommendations to optimize their experimental approach:

  • Antibody validation: Thoroughly validate antibodies for specificity, ideally using knockout controls

  • Expression system selection: Choose expression systems appropriate for the research question, recognizing that E. coli-expressed recombinant protein may lack eukaryotic post-translational modifications

  • Storage optimization: Follow recommended storage guidelines, including aliquoting to avoid freeze-thaw cycles and adding glycerol for long-term stability

  • Reconstitution protocol: Carefully follow reconstitution procedures, centrifuging vials before opening and using appropriate buffer conditions

  • Functional validation: Develop and validate functional assays appropriate to the hypothesized role of tmem116

Additionally, researchers should consider collaborating across disciplines to bring complementary expertise to the complex challenges of membrane protein research. Integrating structural, cellular, and in vivo approaches will likely yield the most comprehensive understanding of tmem116 biology.

How can researchers effectively interpret tmem116 findings in the context of broader cell biology principles?

To effectively interpret tmem116 findings within broader cell biology contexts, researchers should:

  • Consider evolutionary conservation: Compare findings across species to identify fundamental versus specialized functions

  • Examine pathway integration: Place tmem116 within known signaling networks and cellular processes

  • Assess cell-type specificity: Determine whether functions are universal or restricted to specific cellular contexts

  • Evaluate developmental timing: Consider temporal aspects of expression and function during development

  • Connect to disease mechanisms: Relate findings to known pathological processes where membrane protein function is implicated

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.