Recombinant Danio rerio Transmembrane protein 120A (tmem120a)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Hypotheses

TMEM120A is implicated in diverse biological processes:

  • Metabolic Regulation:

    • Binds CoASH, suggesting roles in fatty acid metabolism or CoASH transport.

    • In Caenorhabditis elegans, TMEM120 homologs modulate triacylglycerol synthesis and lipid droplet dynamics ( ).

  • Mechanotransduction:

    • Initially proposed as a mechanosensitive ion channel (TACAN), but recent evidence disputes this. Human TMEM120A does not mediate mechanically activated currents in heterologous systems ( ).

  • Modulation of Piezo Channels:

    • May indirectly regulate mechanosensation by altering lipid composition near Piezo channels ( ).

Research Applications

Recombinant Danio rerio TMEM120A is utilized in:

  • Structural Studies: Investigating CoASH binding and dimerization mechanisms.

  • Functional Assays: Testing interactions with metabolic enzymes (e.g., GOT1, PPP1CC) ( ).

  • Comparative Biology: Exploring evolutionary conservation of TMEM120 family functions.

Unresolved Questions

  • Does zebrafish TMEM120A share the CoASH-binding specificity observed in human homologs?

  • What role does TMEM120A play in zebrafish lipid metabolism or developmental processes?

  • How does its structure compare to mammalian TMEM120A?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem120a; zgc:162139; Ion channel TACAN; Transmembrane protein 120A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem120a
Target Protein Sequence
MLFNPTGLTECLQEWEDLEKDYQQIQDTHRHYKHKLEEVSKLQESCSSSIARQRKKLKDL SESLEECKGAVNPEDVNKIDDIQESIKERPNVFFEMEAFLPKKNGLYLSLVLGNVNVTLL NKQSKFAYKDEYEKFKLYLTVLLLFFSFTCRFLVSYRVVDALFNFLLVWYYCTLTIRESI LINNGSKIKGWWVFQHYVSTFLSGVMLTWPDGELYQMFRNQFLSYSMYINFVQFFQYYYQ SGCLYRLRALGERHNMDLTVEGFQSWMWRGLTFLLPFLFLGHFFQLYNGITLFQMTQLPE WKEWQVLMCGSTFLVLFMGNFFTTLGVVYHKYMDQDKAKGL
Uniprot No.

Target Background

Function
This ion channel plays a crucial role in sensing mechanical pain. It contributes to mechanosensitive currents in nocireceptors, enabling the detection of mechanical pain stimuli. It may also be essential for efficient adipogenesis.
Database Links
Protein Families
TMEM120 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and topology of TMEM120A protein?

TMEM120A forms a tightly packed homodimer with extensive interactions mediated by three key domains: the N-terminal coiled coil domain (CCD), the C-terminal transmembrane domain (TMD), and the re-entrant loop between these domains . Each TMEM120A subunit contains six transmembrane helices (TMs) that form an α-barrel structure . Cryo-EM studies have determined this structure to a resolution of 3.2 Å, revealing that both N- and C-termini are located on the cytosolic side of the membrane . The protein appears to have no discernible ion conduction pathway, contradicting earlier hypotheses about its function as an ion channel . Instead, a deep pocket is formed within the TMD that serves as a binding site for coenzyme A (CoA) .

What are the primary functions of TMEM120A in vertebrates?

TMEM120A functions appear to be multifaceted, with evidence supporting roles in:

  • Adipocyte differentiation and lipid metabolism - Studies show that TMEM120A is preferentially expressed in adipose tissue and plays an important role in adipocyte differentiation . Knockout studies in mice reveal disruption of fat genome organization and lipodystrophy syndrome .

  • Genome organization - TMEM120A contributes to the fat-specific pattern of 3D-spatial genome organization . Its deficiency alters positioning of multiple genes, enhancers, and miRNA-encoding loci between the nuclear periphery and interior .

  • Lipid metabolism enzyme - Structural features of TMEM120A resemble those of elongase for very long-chain fatty acids (ELOVL), suggesting enzymatic functions in fatty acid metabolism rather than functioning as a mechanosensitive channel .

  • Triacylglycerol (TAG) synthesis - In C. elegans, TMEM-120 deficiency retards TAG synthesis and lipid droplet expansion .

How does TMEM120A influence lipid metabolism at the cellular level?

TMEM120A appears to be crucial for normal lipid metabolism through several mechanisms:

  • In C. elegans, loss of TMEM-120 reduces lipid droplet (LD) size and blocks LD expansion . Quantitative analysis using stimulated Raman scattering (SRS) signals showed that tmem-120 mutant worms have 26% less TAG content than wild type worms .

  • In mice, adipocyte-specific knockout of Tmem120a creates a distinct lipodystrophy pathology similar to familial partial lipodystrophy type 2 (FPLD2) .

  • Metabolic studies in mice show that Tmem120a deficiency affects substrate utilization. While control mice on high-fat diet (HFD) exhibited the expected suppression of diurnal cycling between fat and carbohydrate utilization (with respiratory exchange ratio approaching 0.7), knockout mice maintained a consistently higher respiratory exchange ratio, indicating partially retained carbohydrate utilization .

  • Structurally, TMEM120A's ability to bind CoA (a critical cofactor in fatty acid metabolism) supports its role in lipid synthesis or modification pathways .

How does TMEM120A contribute to genome organization and gene expression regulation?

TMEM120A plays a sophisticated role in genome organization with direct consequences for gene expression:

  • Adipocyte-specific knockout of Tmem120a disrupts fat genome organization by altering the positioning of multiple genomic regions .

  • This mispositioning affects:

    • Lipid metabolism pathway genes (broadly suppressed)

    • Myogenic genes (induced)

    • Enhancers

    • miRNA-encoding loci

  • The repositioning occurs between the nuclear periphery and interior, suggesting that TMEM120A normally helps maintain specific genomic loci at the nuclear envelope .

  • Importantly, TMEM120A represents the first demonstration that miRNA-encoding loci are under nuclear envelope positional regulation . This mechanism may explain how TMEM120A deficiency leads to upregulation of muscle genes, potentially through altered miRNA regulation .

What is the nature of the CoA binding site in TMEM120A and its functional significance?

The CoA binding pocket represents a crucial feature of TMEM120A with significant implications for its function:

  • High-quality cryo-EM density maps reveal a clear electron density for a bound ligand within each TMEM120A subunit, which has been identified as CoA .

  • Biochemical verification using liquid chromatography-tandem mass spectrometry (LC-MS/MS) confirmed the presence of both CoA and acetyl-CoA in purified TMEM120A samples .

  • The binding site is located within the transmembrane α-barrel, with the pocket only open to the inside (cytosolic side) but completely sealed from the outside .

  • The conserved HxxHH motif, which is important for the catalytic activity of ELOVL elongases, is present at an equivalent location in TMEM120A, suggesting similar enzymatic functions .

  • This structural feature strongly suggests that TMEM120A functions as an enzyme involved in fatty acid metabolism rather than as an ion channel .

Structural FeatureTMEM120AELOVL Fatty Acid Elongase
Transmembrane topology6-TM α-barrel6-TM α-barrel
Ligand bindingCoA or CoA derivativeCoA or CoA derivative
Catalytic motifContains HxxHH motifContains HxxHH motif
DimerizationForms tightly packed dimerMonomeric
LocationNuclear envelope/EREndoplasmic reticulum

What are the contradictions in the literature regarding TMEM120A's mechanosensitive channel properties?

The literature presents significant contradictions regarding TMEM120A's proposed role as a mechanosensitive channel:

What expression systems are optimal for producing recombinant Danio rerio TMEM120A for structural and functional studies?

Based on successful approaches with human TMEM120A, the following expression system considerations apply to the zebrafish ortholog:

  • Expression system selection:

    • HEK293F cells using the BacMam expression system have proven successful for human TMEM120A expression

    • For the zebrafish ortholog, consider both mammalian and insect cell expression systems to identify optimal yield and proper folding

  • Construct design:

    • Include an N-terminal affinity tag (such as Flag tag) for purification

    • Consider fusion partners that enhance membrane protein expression and stability

    • Generate both full-length and truncated constructs to identify stable domains

  • Purification approach:

    • Solubilization using lauryl maltose neopentyl glycol (LMNG) detergent

    • Final purification in digitonin detergent to maintain native-like lipid interactions

    • Verify protein quality using size-exclusion chromatography

    • Confirm homodimer formation, which is essential for proper function

  • Functional validation:

    • Evaluate CoA binding using LC-MS/MS to confirm proper folding

    • Assess enzymatic activity with potential fatty acid substrates

    • Compare properties with human ortholog to identify conserved features

How should researchers design knockout and knockdown models to study TMEM120A function in zebrafish?

When designing genetic models to study tmem120a function in zebrafish, consider the following methodology:

  • CRISPR-Cas9 knockout strategy:

    • Target conserved regions of the tmem120a gene, particularly within the transmembrane domain or CoA binding site

    • Design multiple guide RNAs to increase editing efficiency

    • Include controls for off-target effects

    • Verify knockout using both genomic sequencing and protein expression analysis

  • Critical phenotypic analyses:

    • Adipose tissue development and lipid distribution (oil red O staining)

    • Lipid droplet size and number in adipocytes

    • Metabolic parameters (respiratory exchange ratio)

    • Gene expression changes in adipose, muscle, and liver tissues

    • Genome organization using fluorescence in situ hybridization (FISH)

  • Compensatory mechanisms:

    • Assess expression changes in tmem120b (paralog) to identify potential compensation

    • Consider generating double knockouts if compensation is observed

    • Evaluate changes in related metabolic enzymes, particularly those involved in fatty acid elongation

  • Tissue-specific approaches:

    • Develop tissue-specific knockout models using Cre-lox systems

    • Focus particularly on adipose tissue given the established role of TMEM120A in adipocyte function

    • Compare with global knockout to identify tissue-specific versus systemic effects

How can researchers differentiate between direct and indirect effects of TMEM120A on gene expression?

To distinguish direct from indirect effects of TMEM120A on gene expression:

  • Integrative genomics approach:

    • Combine DamID or ChIP-seq to identify genome regions associated with TMEM120A at the nuclear envelope

    • Correlate with RNA-seq data to identify genes whose expression changes with tmem120a manipulation

    • Perform time-course experiments after inducible TMEM120A depletion to identify primary versus secondary responses

  • Genome organization analysis:

    • Use DNA-FISH to track repositioning of specific loci following TMEM120A manipulation

    • Apply chromosome conformation capture techniques (Hi-C, 4C) to identify changes in chromatin interaction patterns

    • Focus particularly on lipid metabolism genes and myogenic genes shown to be affected in mouse models

  • miRNA regulatory networks:

    • Profile miRNA expression changes following TMEM120A manipulation

    • Correlate with mRNA changes to identify miRNA-mediated effects

    • Validate key miRNA-target interactions using reporter assays

  • Metabolic feedback mechanisms:

    • Monitor lipid metabolite levels to identify whether metabolic changes drive gene expression changes

    • Use metabolic inhibitors to block specific pathways and determine effects on gene expression independent of TMEM120A

What analytical approaches can resolve contradictions regarding TMEM120A's cellular localization and function?

To address contradictions about TMEM120A's localization and function:

  • Super-resolution microscopy:

    • Employ techniques like STORM or PALM to precisely localize TMEM120A

    • Use co-localization with markers for nuclear envelope, ER, and plasma membrane

    • Quantify relative distribution across cellular compartments

  • Biochemical fractionation:

    • Perform careful subcellular fractionation to isolate nuclear envelope, ER, and plasma membrane

    • Quantify relative abundance of TMEM120A in each fraction using western blotting

    • Compare results across different cell types, particularly adipocytes and neurons

  • Functional domain mapping:

    • Generate chimeric constructs to identify domains responsible for different subcellular localizations

    • Create point mutations in the CoA binding site to assess effects on localization and function

    • Develop domain-specific antibodies for localization studies

  • Functional assays to distinguish potential roles:

    • Enzymatic activity assays to assess fatty acid modification functions

    • Genome organization assays to evaluate nuclear envelope functions

    • Patch-clamp experiments under strictly controlled conditions to evaluate potential channel activity

How might zebrafish models illuminate TMEM120A's role in lipodystrophy and metabolic disorders?

Zebrafish represent a valuable model system for studying TMEM120A's role in metabolic disorders:

  • Advantages of zebrafish for metabolic studies:

    • Optical transparency allowing visualization of lipid dynamics in vivo

    • Rapid development and high fecundity for genetic studies

    • Conservation of key metabolic pathways

    • Amenability to high-throughput drug screening

  • Lipodystrophy model development:

    • Generate zebrafish tmem120a knockout models to compare with the lipodystrophy phenotype observed in mice

    • Characterize lipid distribution, adipose tissue development, and metabolic parameters

    • Develop diet-induced obesity models in wild-type and tmem120a-deficient fish to parallel the high-fat diet studies in mice

  • Therapeutic screening:

    • Once a lipodystrophy phenotype is established, screen for compounds that rescue normal adipose tissue development

    • Focus on compounds that normalize gene expression patterns, particularly those affecting lipid metabolism and myogenic genes

    • Test compounds that modulate CoA metabolism given TMEM120A's CoA binding properties

  • Comparative genomics:

    • Compare genome organization changes in zebrafish tmem120a mutants with those observed in mouse models

    • Identify conserved versus species-specific gene regulatory networks

    • Focus on evolutionarily conserved metabolic gene clusters

What is the evolutionary significance of TMEM120A's structural similarity to fatty acid elongases?

The structural similarity between TMEM120A and ELOVL fatty acid elongases raises intriguing evolutionary questions:

  • Evolutionary relationship analysis:

    • Perform comprehensive phylogenetic analysis of TMEM120A and ELOVL family proteins across species

    • Identify when these protein families diverged and potential selective pressures

    • Compare sequence conservation in key structural domains, particularly the transmembrane barrel and CoA binding site

  • Structure-function relationships:

    • The TMDs of both proteins contain a 6-TM α-barrel with similar topology and architecture

    • Both proteins bind CoA or CoA derivatives in the pocket of the 6-TM barrel

    • The conserved HxxHH motif important for catalytic activity in ELOVLs is present in TMEM120A

    • Compare active site geometry and substrate binding pockets

  • Functional convergence versus divergence:

    • Test whether zebrafish TMEM120A possesses elongase-like enzymatic activity

    • Compare substrate specificity between TMEM120A and various ELOVL family members

    • Identify unique structural features that might confer novel functions to TMEM120A beyond fatty acid elongation

  • Dual-function hypothesis:

    • Investigate whether TMEM120A's nuclear envelope localization allows it to coordinate genome organization with metabolic state

    • Test if enzymatic activity and genome organizing functions are separable or interdependent

    • Develop models explaining how a protein with structural similarity to fatty acid elongases evolved additional nuclear envelope functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.