Recombinant Danio rerio Transmembrane protein 147 (tmem147)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of this protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem147; zgc:92863; Transmembrane protein 147
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem147
Target Protein Sequence
MTLFHFGNCFSLAYFPYFITYKCSGLSEYNAFWRCVQAGATYLFVRLCKMLFLATFFPTW EGGAGVYDFVGEFMKATVDMADLLGLHLVMSRNAGKGEYKIMVAAMGWATAELIMSRCIP LWVGARGIEFDWKYIQMSFDSNISLVHYIAMAAVVWMFTRYDLPKSFRLPVAILLGLCVY KGFLMELFVHVFLLGSWTALLVKAVLTGAISLCSLFLFVTLVHSN
Uniprot No.

Target Background

Function
Essential for translocation within the endoplasmic reticulum and the biogenesis of multi-pass membrane proteins.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the relationship between TMEM147 and the Nicalin-NOMO complex?

TMEM147 is a novel core component of the Nicalin-NOMO complex . Research has demonstrated that:

  • TMEM147 co-immunoprecipitates with Nicalin and NOMO components

  • Assembly of the complex appears hierarchical, similar to γ-secretase, beginning with a Nicalin-NOMO intermediate

  • Nicalin acts as the limiting factor regulating assembly by stabilizing TMEM147 and NOMO

Overexpression and knockdown experiments in cultured cells confirm the close relationship between these three proteins, suggesting they function as components of the same complex .

How is tmem147 expressed during zebrafish development?

TMEM147 is expressed during early zebrafish development, similar to its complex partners Nicalin and NOMO . In situ hybridization studies have been conducted using linearized vector pCS2+/MEM as template for cRNA probe synthesis with the DIG RNA labeling kit (SP6/T7) . For optimal visualization of expression patterns in day 2 zebrafish embryos, researchers typically bleach specimens prior to in situ hybridization using 3% H₂O₂, 0.5% KOH, following standardized protocols for embryo maintenance at 28°C .

What experimental approaches are most effective for studying TMEM147 protein interactions?

For investigating TMEM147 interactions with other proteins, researchers have successfully employed:

  • Co-immunoprecipitation assays: Using V5-tagged TMEM147 constructs to precipitate potential binding partners. This approach successfully identified Nicalin and NOMO as interaction partners, showing enrichment of 60-kDa and 130-kDa proteins representing these components .

  • Subcellular colocalization studies: Co-transfection with TMEM147-GFP and ER-DsRed (ER marker) demonstrates overlapping signals, confirming ER localization .

  • Domain mapping experiments: For identifying critical interaction domains, researchers have generated deletion mutants. Similar approaches used with MAVS and STING proteins showed that the PRO domain was essential for interaction .

  • Membrane fractionation: Given TMEM147's hydrophobic nature, detergent-based extraction methods optimized for membrane proteins are recommended, with special attention to maintaining protein stability during purification.

How does TMEM147 silencing affect ER structure and function?

TMEM147 plays a crucial role in regulating ER morphology and extent. Quantitative analysis has revealed that TMEM147 silencing causes:

  • Significant increases in both curved (RTN4) and flat (CLIMP63/CKAP4) ER markers

  • General expansion of the ER compartment

  • A profound shift toward flat ER areas

  • Concurrent reduction in DNA condensation

These findings suggest TMEM147 functions as a critical regulator of ER composition and structure. For researchers aiming to study these effects, quantitative immunofluorescence microscopy focusing on ER markers is recommended, along with appropriate controls to account for cell cycle effects.

What protein networks and signaling pathways are associated with TMEM147?

Comprehensive protein network and pathway analyses have identified several significant TMEM147-associated functions:

Functional CategoryAssociated Proteins/PathwaysResearch Method
Ribosome bindingRibosomal assembly factorsProteomic analysis
Oxidoreductase activityRedox enzymesPathway mapping
G protein-coupled receptor activityGPCR signaling componentsNetwork analysis
Transmembrane transportTransport channels and facilitatorsInteractome studies

For researchers exploring TMEM147's role in these pathways, computational prediction tools combined with targeted experimental validation are recommended . Hub proteins identified through these analyses represent promising targets for future functional studies.

How can I optimize expression and purification of recombinant zebrafish TMEM147?

For optimal expression and purification of recombinant zebrafish TMEM147:

  • Expression system: E. coli has been successfully used for expressing full-length Danio rerio TMEM147 (1-225aa) with an N-terminal His tag .

  • Purification strategy: His-tag affinity chromatography followed by appropriate buffer exchange.

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquot for multiple use

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • The recommended final glycerol concentration is 50%

What are the differences between TMEM47 and TMEM147 in zebrafish models?

While both are transmembrane proteins expressed in zebrafish, TMEM47 and TMEM147 serve distinct biological functions:

  • TMEM47: Functions as an IFN-negative regulator during viral infection. It:

    • Represses IFN expression stimulated by both RNA and DNA viruses

    • Interacts with MAVS and STING, promoting their degradation through autophagy-lysosome-dependent mechanisms

    • Requires autophagy-related gene 5 (ATG5) for its regulatory function

    • Localizes to the ER, where it associates with these signaling components

  • TMEM147: Functions as a component of the Nicalin-NOMO complex. It:

    • Localizes to both NE and ER

    • Regulates nuclear shape, lamina and chromatin dynamics, and cholesterol synthesis

    • Influences ER morphology and structure

    • Participates in protein production and transport networks

For researchers designing studies involving either protein, understanding these distinct functional profiles is essential to avoid misattribution of observed phenotypes.

What methods are most effective for analyzing TMEM147 function in zebrafish development?

To effectively analyze TMEM147 function during zebrafish development:

  • Gene expression analysis: RT-qPCR has been successfully used to quantify expression levels at various developmental time points, as demonstrated with the related protein Nomo1 .

  • CRISPR/Cas9 knockout: Design sgRNAs targeting conserved functional domains. For Nomo1, targeting exon 7 (located before the functional EMC7-beta-sandw domain) proved effective .

  • Phenotypic analysis: Behavioral assays should be conducted to assess potential neurodevelopmental impacts:

    • Locomotion and thigmotaxis tests

    • Social behavior assessment (interindividual distance in shoals)

    • Repetitive behavior quantification (back-and-forth motion, stereotypic movement, circular swimming)

  • In situ hybridization: For spatial expression pattern analysis during development, using DIG-labeled RNA probes with appropriate controls has proven effective .

How should I design experiments to investigate TMEM147's role in the Nicalin-NOMO complex assembly?

To effectively study TMEM147's role in complex assembly:

  • Hierarchical assembly analysis: Design pulse-chase experiments to track the temporal sequence of protein interactions during complex formation.

  • Limiting factor assessment: Implement controlled overexpression and knockdown of individual components (Nicalin, NOMO, TMEM147) combined with quantitative co-immunoprecipitation to determine:

    • Which component(s) stabilize others

    • Rate-limiting steps in assembly

    • Subcomplex formation dynamics

  • Structural domain mapping: Generate truncation and point mutants targeting:

    • Transmembrane domains of TMEM147

    • Interaction interfaces between components

    • Residues conserved across species

  • Functional readouts: Employ reporter systems sensitive to complex formation, such as trafficking assays or enzymatic activity measurements associated with the intact complex.

The current evidence suggests that, similar to γ-secretase, assembly begins with a Nicalin-NOMO intermediate, with Nicalin serving as the limiting factor that stabilizes the other components .

What controls should be included when studying TMEM147 impacts on ER morphology?

When investigating TMEM147's effects on ER morphology, include the following controls:

  • Cell cycle normalization: Since ER morphology changes during cell cycle progression, synchronize cells or account for cell cycle stage in analyses.

  • Multiple ER markers: Quantify both curved (RTN4) and flat (CLIMP63/CKAP4) ER markers to comprehensively assess structural changes.

  • Rescue experiments: Complement knockdown studies with rescue using wild-type and mutant variants to confirm specificity.

  • Alternative silencing approaches: Employ multiple siRNA sequences or CRISPR-based methods to rule out off-target effects.

  • Related protein controls: Include analysis of known ER-shaping proteins (Atlastins, Reticulons) to contextualize TMEM147-specific effects relative to established regulators.

Previous research has shown that TMEM147 silencing causes area and intensity increases for both RTN4 and CLIMP63, suggesting a broader impact on ER homeostasis .

How might TMEM147 research contribute to understanding neurodevelopmental disorders?

Recent findings connect the Nicalin-NOMO-TMEM147 complex to neuronal development. The associated protein Nomo1, when deficient in zebrafish, causes autism-like behavior . Given TMEM147's role in this complex, researchers should consider:

  • Behavioral phenotyping: Assess TMEM147-deficient zebrafish for:

    • Social interaction deficits (using interindividual distance measurements)

    • Repetitive behaviors (quantifying stereotypic movements)

    • Locomotion patterns (analyzing thigmotaxis)

  • Molecular interaction studies: Investigate how TMEM147 interacts with neuronal signaling components, particularly in ER-dependent processes like calcium homeostasis and protein folding.

  • Therapeutic targeting potential: Given its regulatory role in multiple cellular processes, exploring modulation of TMEM147 activity could open new therapeutic avenues for neurodevelopmental conditions.

The autism-like phenotypes observed in Nomo1-deficient zebrafish (decreased social preference, increased repetitive behaviors) suggest this pathway may have broader implications for human neurological conditions .

What computational approaches can help predict TMEM147 functions beyond current experimental evidence?

To expand understanding of TMEM147 function:

  • Protein network expansion: Apply algorithms to identify potential interaction partners based on:

    • Structural similarity to known interactors

    • Co-expression patterns across tissues and developmental stages

    • Evolutionary conservation of interaction interfaces

  • Pathway enrichment analysis: Identify significantly associated biological processes using Gene Ontology and pathway databases, focusing on:

    • ER-associated functions

    • Membrane protein trafficking

    • Developmental signaling cascades

  • Structural prediction: Apply advances in protein structure prediction (such as AlphaFold) to model:

    • Transmembrane domain organization

    • Potential interaction interfaces

    • Conformational changes upon complex formation

Current research has already identified ribosome binding, oxidoreductase activity, G protein-coupled receptor activity, and transmembrane transport as TMEM147-associated functions , providing a foundation for expanded computational exploration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.