Recombinant Danio rerio Transmembrane protein 160 (tmem160)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem160; si:ch211-113p18.5; Transmembrane protein 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem160
Target Protein Sequence
MASIRWLMGSRLSRFVCPFAQLVRQPVLRYVRPPVRALHRGSVRRAAEKNPLNSRARAVE QQYITELDKADALMLRKSHETGFLSWFRNGLLATGIGVIAFVQSDVGREAGYAFFILGGM CVSFGGASYVTSLLSLRRIMLLSLPAVLLHTAVVSSAALFWLCAVSLYIGRLEVEIIHDE DDEEHGADESSECAECRARRDREKGQDK
Uniprot No.

Target Background

Database Links

KEGG: dre:559491

UniGene: Dr.86509

Protein Families
TMEM160 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM160 and what is its localization in cells?

TMEM160 (Transmembrane protein 160) is a protein that localizes to the mitochondrial inner membrane. This localization has been confirmed through immunofluorescence studies in which TMEM160-Myc-DYKDDDDK-expressing HeLa cells showed colocalization with MitoTracker Red, a mitochondrial marker . Further subcellular fractionation experiments have demonstrated that TMEM160 is detected in the alkali-resistant pellet fraction along with other mitochondrial inner membrane proteins like MTCO1 (mitochondrially encoded cytochrome c oxidase I) . This confirms its identity as a transmembrane protein embedded in the mitochondrial inner membrane rather than a soluble or peripherally associated protein.

How should recombinant Danio rerio TMEM160 be stored and handled for optimal stability?

For optimal stability, recombinant Danio rerio TMEM160 should be stored in a Tris-based buffer containing 50% glycerol . The protein should be kept at -20°C for regular storage, while -80°C is recommended for extended storage periods . It is important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity . For ongoing experiments, working aliquots can be prepared and stored at 4°C for up to one week to minimize freeze-thaw cycles . This storage protocol helps maintain the structural integrity and functional properties of the recombinant protein for research applications.

How does TMEM160 knockdown affect mitochondrial function and cellular responses?

Contrary to earlier reports suggesting minimal impact, TMEM160 knockdown significantly alters multiple cellular pathways . When TMEM160 is depleted, cells show upregulation of the mitochondrial chaperone HSPD1, indicating activation of the mitochondrial unfolded protein response (UPRmt) . This response involves increased expression of key transcription factors, including ATF4, ATF5, and DDIT3, which are central regulators of cellular stress responses . Additionally, mitochondrial protein import receptors TOMM22 and TOMM20 show enhanced expression following TMEM160 depletion, suggesting alterations in mitochondrial protein import mechanisms .

Perhaps most significantly, TMEM160 knockdown leads to a substantial increase in reactive oxygen species (ROS) generation . This oxidative stress persists even after treatment with ROS scavengers like N-acetylcysteine (NAC), indicating that the UPRmt induction occurs independently of ROS generation . These findings suggest that TMEM160 plays a crucial role in maintaining mitochondrial homeostasis by suppressing ROS generation and preventing the degradation of specific mitochondrial proteins.

What is the relationship between TMEM160 and cancer progression?

Recent research has uncovered a significant relationship between TMEM160 and tumor growth, particularly in lung adenocarcinoma (LUAD) . Interactome analysis reveals that TMEM160 associates with proteins involved in multiple cancer-related pathways, including DNA replication, cell cycle, apical junction formation, xenobiotic metabolism, glycolysis, epithelial-mesenchymal transition (EMT), mitotic spindle assembly, reactive oxygen species management, UV response DNA repair, and the P53 pathway .

The connection to EMT is particularly notable, as this cellular process is crucial for tumor cell invasion and metastasis formation . Additionally, TMEM160's association with xenobiotic metabolism pathways suggests potential involvement in chemoresistance mechanisms, including drug efflux, therapeutic compound inactivation, DNA damage repair, and antioxidant enzyme activity . Previous studies have also indicated that TMEM160 promotes radiotherapy resistance in colorectal cancer cells through immune system evasion, further highlighting its multifaceted role in cancer biology .

What contradictions exist in the literature regarding TMEM160 function?

This discrepancy highlights the complexity of mitochondrial protein functions and the challenges in accurately characterizing them. The contradictory findings may result from differences in experimental approaches, cell types used, knockdown efficiency, or the specific parameters measured to assess mitochondrial function . Resolving these contradictions requires careful experimental design with comprehensive assessment of multiple mitochondrial functions and cellular responses, using complementary approaches to validate findings.

What techniques are most effective for studying TMEM160 localization in cells?

For studying TMEM160 localization, a multi-faceted approach combining immunofluorescence microscopy and subcellular fractionation has proven most effective . The immunofluorescence protocol involves:

  • Culturing cells expressing tagged TMEM160 (e.g., TMEM160-Myc-DYKDDDDK) on coverslips

  • Treating with MitoTracker Red to label mitochondria

  • Fixing with 4% paraformaldehyde

  • Permeabilizing with PBS containing 0.1% Triton X-100

  • Immunostaining with appropriate primary antibodies (anti-DYKDDDDK)

  • Detecting with fluorescently-labeled secondary antibodies (e.g., Alexa Fluor488)

  • Counterstaining nuclei with Hoechst dye

This approach should be complemented with subcellular fractionation and alkali extraction to confirm membrane integration. This involves:

  • Isolating mitochondria through differential centrifugation

  • Treating with Na₂CO₃ (pH 11.5) to distinguish integral membrane proteins from peripheral ones

  • Western blotting analysis using markers for different mitochondrial compartments (MTCO1 for inner membrane, VDAC1 for outer membrane, ATP5A for inner membrane-faced proteins, and HSPA9 for matrix proteins)

Together, these techniques provide compelling evidence for the precise subcellular localization of TMEM160.

How can researchers effectively analyze the effects of TMEM160 knockdown?

To comprehensively analyze TMEM160 knockdown effects, researchers should implement a multi-parameter assessment approach:

  • Gene expression analysis: Quantitative RT-PCR and RNA-seq to detect changes in expression of UPRmt factors (ATF4, ATF5, DDIT3), mitochondrial chaperones (HSPD1), and mitochondrial import machinery components (TOMM20, TOMM22)

  • Protein expression analysis: Western blotting to assess changes in protein levels, using antibodies against key markers of mitochondrial function and stress responses

  • ROS measurement: Fluorescent probes such as DCFDA (2',7'-dichlorofluorescin diacetate) to quantify cellular ROS levels before and after TMEM160 knockdown

  • Protein modification assessment: Immunoblot analysis using anti-4-HNE antibody to detect 4-HNE-modified proteins, which indicate oxidative stress-induced protein modifications

  • Rescue experiments: Treating cells with ROS scavengers like N-acetylcysteine (NAC) to determine whether observed effects are ROS-dependent or independent

This comprehensive approach allows for distinguishing between primary effects of TMEM160 depletion and secondary consequences, providing clearer insights into the protein's function.

What are the recommended protocols for immunohistochemical detection of TMEM160 in tissue samples?

For immunohistochemical detection of TMEM160 in tissue samples, the following optimized protocol is recommended:

  • Tissue preparation: Fix tissues in 4% paraformaldehyde and embed in paraffin blocks

  • Sectioning: Cut tissues into layers up to 3 mm thick and place on charged slides

  • Deparaffinization: Heat slides at 60°C for one hour

  • Antigen retrieval: Immerse slides in 10 mM sodium citrate buffer solution (pH 6) and heat in a pressure cooker for 15 minutes

  • Peroxidase blocking: Incubate with endogenous peroxidase blocking solution (e.g., from Mohs mouse/rabbit brown PoliDetector DAB HRP kit) for 15 minutes, twice

  • General blocking: Apply bovine serum albumin (BSA) solution and fetal bovine serum (FBS)

  • Primary antibody incubation: Incubate overnight in a moist chamber at 4°C with anti-TMEM160 (1:200 dilution; rabbit IgG)

  • Secondary antibody incubation: Incubate for 1 hour with horseradish peroxidase (HRP)-conjugated secondary antibody at room temperature

  • Development: Develop with diaminobenzidine tetrahydrochloride

  • Counterstaining: Counterstain with hematoxylin

This protocol has been successfully applied in studies examining TMEM160 expression in lung cancer tissues compared to adjacent non-tumor lung tissues, providing reliable and reproducible results.

How does TMEM160 interact with other proteins in cellular pathways?

Interactome analysis reveals that TMEM160 interacts with numerous proteins involved in essential cellular processes . Using proteomic approaches, 489 proteins have been identified as exclusive interactors with TMEM160 compared to control groups . When cross-referenced with genes commonly upregulated in mixed subtype lung adenocarcinoma (LUAD), 10 shared genes emerge as particularly significant .

Gene Ontology (GO) enrichment analysis of these shared interactors reveals significant enrichment in pathways related to:

  • DNA replication

  • Amino acid biosynthesis

  • Cell cycle regulation

These interactions suggest that TMEM160 plays roles beyond its mitochondrial localization, potentially influencing nuclear processes and cell proliferation mechanisms. The protein's interactions with components of various cancer-related pathways further support its multifunctional nature, with potential implications for both normal cellular function and disease states.

What experimental approaches can resolve contradictory findings about TMEM160 function?

To resolve contradictory findings regarding TMEM160 function, researchers should implement a multi-faceted experimental strategy:

  • Employ multiple knockdown/knockout methods: Use both siRNA-mediated knockdown and CRISPR-Cas9 gene editing to ensure results are not artifacts of a particular technique

  • Conduct time-course experiments: Assess effects at various time points after TMEM160 depletion to distinguish between immediate and secondary responses

  • Use multiple cell lines: Test effects in diverse cell types to determine whether TMEM160 functions are cell-type specific

  • Apply complementary functional assays: Measure multiple parameters of mitochondrial function, including:

    • Membrane potential (using JC-1 or TMRE dyes)

    • ATP production

    • Oxygen consumption rate

    • Mitochondrial morphology

    • ROS levels

    • Protein import efficiency

  • Perform rescue experiments: Reintroduce wild-type TMEM160 and mutant variants to determine which domains are essential for restoring normal function

  • Conduct in vivo studies: Extend findings to animal models (particularly zebrafish, since we're discussing Danio rerio TMEM160) to assess physiological relevance

This comprehensive approach can help reconcile contradictory findings by providing a more complete picture of TMEM160 function across different experimental contexts.

What are the most promising areas for future TMEM160 research?

Based on current knowledge gaps, several promising research directions for TMEM160 emerge:

  • Structural biology approaches: Determine the three-dimensional structure of TMEM160 to understand how its transmembrane domains are arranged and identify potential binding sites for interacting partners or small molecules

  • Tissue-specific functions: Investigate whether TMEM160 has differential roles across various tissues in Danio rerio and other organisms, particularly focusing on high-energy demanding tissues where mitochondrial function is critical

  • Developmental biology: Examine the role of TMEM160 during embryonic development in zebrafish, taking advantage of their transparency and rapid development to track mitochondrial dynamics in real-time

  • Cancer therapeutics: Explore whether targeting TMEM160 could sensitize cancer cells to radiotherapy or chemotherapy, based on its apparent role in therapy resistance mechanisms

  • Mitochondrial disease models: Determine if TMEM160 dysfunction contributes to mitochondrial disorders and whether modulating its activity could have therapeutic potential

  • Evolutionary conservation analysis: Compare TMEM160 function across species to identify conserved roles and species-specific adaptations, providing insights into its fundamental importance

These research directions would significantly advance our understanding of TMEM160 biology and potentially reveal new therapeutic targets for diseases associated with mitochondrial dysfunction or cancer.

How might TMEM160 research inform our understanding of mitochondrial dysfunction in disease?

TMEM160 research has significant potential to enhance our understanding of mitochondrial dysfunction in disease through several mechanisms:

  • Mitochondrial stress response regulation: The link between TMEM160 depletion and UPRmt activation suggests it may be a key regulator of how cells respond to mitochondrial stress . Understanding this regulation could provide insights into diseases where mitochondrial stress responses are dysregulated, including neurodegenerative disorders and metabolic diseases.

  • ROS management: The dramatic increase in ROS generation following TMEM160 knockdown indicates its importance in oxidative stress management . This has implications for aging-related diseases and conditions associated with oxidative damage.

  • Cancer metabolism: TMEM160's interactions with pathways involved in cancer progression suggest it may influence metabolic reprogramming in cancer cells . This could provide new perspectives on the Warburg effect and other metabolic adaptations that support tumor growth.

  • Therapeutic targeting: Understanding how TMEM160 promotes therapy resistance could inform development of adjuvant therapies that enhance the effectiveness of existing cancer treatments .

By bridging the gap between basic mitochondrial biology and disease mechanisms, TMEM160 research represents a valuable avenue for identifying novel therapeutic approaches for conditions associated with mitochondrial dysfunction.

What is the current consensus on TMEM160 function based on available evidence?

The current consensus on TMEM160 function, based on the available evidence, indicates that it is a mitochondrial inner membrane protein with multifaceted roles in cellular homeostasis . While earlier studies suggested minimal impact of its loss on mitochondrial function, more recent research clearly demonstrates that TMEM160 depletion triggers significant cellular responses, including activation of the mitochondrial unfolded protein response (UPRmt), altered mitochondrial protein import, and increased reactive oxygen species (ROS) generation .

Additionally, TMEM160 appears to have functions that extend beyond basic mitochondrial maintenance, with emerging evidence suggesting roles in cancer progression, particularly in lung adenocarcinoma . Its interactions with proteins involved in DNA replication, cell cycle regulation, and epithelial-mesenchymal transition indicate that TMEM160 may serve as a bridge between mitochondrial function and broader cellular processes related to proliferation and stress adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.