Recombinant Danio rerio Transmembrane protein 170A (tmem170a)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 170A (TMEM170A) is a protein that regulates the morphogenesis of the endoplasmic reticulum (ER) and the nuclear envelope . It influences the balance between tubular ER and ER sheets, promoting the formation of ER sheets . TMEM170A is found in various organisms, including Homo sapiens (humans) , Mus musculus (mouse) , and Danio rerio (zebrafish) .

General Information

PropertyDescription
NameTransmembrane protein 170A (TMEM170A)
FunctionRegulator of endoplasmic reticulum (ER) and nuclear envelope (NE) morphogenesis
LocalizationEndoplasmic reticulum (ER) and nuclear envelope membranes
SizeHuman TMEM170A is a small protein of 15.25 kDa
DomainsContains three transmembrane domains
Predicted TopologyN-terminus is predicted to be luminal, and the C-terminus is cytoplasmic
Expression EffectsSilencing or overexpressing TMEM170A in HeLa K cells alters ER shape and morphology; downregulation induces tubular ER formation, while overexpression induces ER sheet formation

TMEM170A in Human Cells

TMEM170A, a human transmembrane protein, is located in the ER and nuclear envelope membranes . Studies show that altering TMEM170A levels in HeLa K cells changes the shape and structure of the ER .

  • ER Morphology: Downregulating TMEM170A encourages the formation of tubular ER, whereas increasing TMEM170A results in the creation of ER sheets. This suggests TMEM170A is a key factor in determining ER structure .

  • Nuclear Impact: Decreasing TMEM170A affects the nucleus's shape and size, decreases the density of nuclear pore complexes (NPCs) in the nuclear envelope, and either reduces inner nuclear membrane (INM) proteins or causes them to move to the ER .

  • Interaction with Reticulon 4 (RTN4): TMEM170A interacts with RTN4, and these two proteins have opposing effects on ER shape, as well as nuclear envelope and NPC formation .

Effects of TMEM170A Silencing

When TMEM170A is silenced, several changes occur within the cell's structure and function.

  • ER Disruption: The ER loses its typical homogenous perinuclear localization and tends to aggregate when TMEM170A is silenced. Additionally, there is a decrease in the signal from CLIMP-63, a marker specific to ER sheets, and a significant reduction of CLIMP-63 protein levels .

  • Nuclear Envelope Changes: Silencing TMEM170A induces frequent invagination or evagination of the nuclear envelope, which aligns with the observed changes in nuclear shape .

  • NPC Density Reduction: Decreasing TMEM170A reduces the density of NPCs. The levels of various nucleoporins, including Nup62, Nup160, ELYS, and Pom121, are also reduced following silencing .

Effects of TMEM170A Overexpression

  • ER Sheet Proliferation: Overexpressing TMEM170A leads to an expanded volume of CLIMP-63-positive ER. The ER structure shows highly proliferated ER, composed of well-organized and extensive ER sheet stacks, decorated with membrane-bound ribosomes .

  • Nuclear Size Reduction: Overexpression of TMEM170A causes a reduction of nuclear surface area and nuclear volume .

Role in Nuclear Pore Complex (NPC) Formation and Inner Nuclear Membrane (INM) Protein Distribution

  • NPC Reduction: Decreasing TMEM170A reduces NPC formation or accumulation .

  • INM Protein Mislocalization: In the absence of TMEM170A, the distribution of several INM proteins is affected. LAP2β shows a reduced signal at the nuclear rim, emerin nuclear rim staining is also reduced with partial mislocalization from the INM to the ER, and LBR is prominently mislocalized to the ER and found in ER-associated aggregates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please inform us for preferential development.
Synonyms
tmem170a; tmem170; si:dkey-6e12.5; zgc:66371; Transmembrane protein 170A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem170a
Target Protein Sequence
MIEALIVGEMQDVQIGFVKQILSLNLVPRSNNTTCGNNTSLCDFSEMWYGVFLWAVVSSL IFHLPAALLALATLRRHKVARFFPLGILLMGIIGPLFGGVLTSAAIAGVYKAAGKSMFSL EALVFGVGQSLFIFIISFLRILATL
Uniprot No.

Target Background

Function
May regulate endoplasmic reticulum (ER) membrane morphogenesis by promoting ER sheet formation over tubule formation.
Database Links
Protein Families
TMEM170 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope.

Q&A

What is TMEM170A and what is its biological significance?

TMEM170A is a small transmembrane protein (15.25 kDa in humans) that localizes to the endoplasmic reticulum (ER) and nuclear envelope membranes. It plays a critical role in ER morphogenesis, specifically functioning as an ER-sheet-promoting protein. TMEM170A is conserved across major eukaryotic phyla, including zebrafish (Danio rerio), suggesting its fundamental importance in cellular organization . Research has demonstrated that TMEM170A not only impacts peripheral ER structure but also influences nuclear envelope expansion, nuclear pore complex (NPC) formation, and inner nuclear membrane (INM) protein targeting .

Methodologically, researchers should approach TMEM170A studies through combined localization analysis, gene silencing experiments, and overexpression studies to fully understand its multifaceted roles in membrane organization.

What methods are effective for studying TMEM170A localization and function?

Several complementary approaches have proven effective for studying TMEM170A:

  • Fluorescent protein tagging: Creating fusion proteins (e.g., TMEM170A-GFP) allows for live-cell imaging and co-localization studies with ER and nuclear envelope markers. Human studies have successfully used C-terminal GFP, FLAG, and myc tags .

  • Immunofluorescence microscopy: For fixed cell analysis, using antibodies against TMEM170A alongside markers for ER (calnexin, RTN4), ER sheets (CLIMP-63), and nuclear envelope components (lamin A, LAP2β) .

  • RNAi-mediated silencing: siRNA targeting of TMEM170A allows for loss-of-function studies. Researchers should design control experiments using negative control siRNA and conduct rescue experiments to confirm specificity .

  • Overexpression studies: Transfecting cells with TMEM170A expression constructs enables gain-of-function analysis. This approach has successfully demonstrated TMEM170A's role in promoting ER sheet formation .

  • Ultrastructural analysis: Transmission electron microscopy (TEM) and 3D electron tomography are essential for high-resolution analysis of ER morphology changes following TMEM170A manipulation .

When adapting these approaches to zebrafish systems, researchers should consider species-specific optimization of transfection protocols and antibody selection.

How can I design effective knockdown and rescue experiments for zebrafish TMEM170A?

Designing rigorous knockdown and rescue experiments for zebrafish TMEM170A requires careful consideration of several factors:

  • Knockdown strategy:

    • For cell culture: Use siRNAs targeting specific regions of tmem170a mRNA. Design multiple siRNAs targeting different regions to control for off-target effects.

    • For whole zebrafish: Consider morpholino antisense oligonucleotides or CRISPR-Cas9 approaches.

  • Validation of knockdown efficiency:

    • Quantify reduction in TMEM170A protein levels via western blotting

    • Assess mRNA reduction through qRT-PCR

  • Rescue experiment design:

    • Express a version of TMEM170A resistant to the knockdown approach (e.g., using an siRNA targeting the 3'UTR and expressing a coding-sequence-only construct) .

    • Include appropriate controls: untransfected cells, negative control siRNA, and knockdown without rescue.

  • Phenotypic assessment:

    • Examine ER morphology changes using markers like calnexin, RTN4, and CLIMP-63

    • Analyze nuclear envelope architecture and NPC formation

    • Quantify changes in ER sheet versus tubule ratios

A well-designed rescue experiment was demonstrated in human cells where TMEM170A-silenced cells were transfected with FLAG-tagged TMEM170A to restore protein levels, providing a methodological blueprint for zebrafish studies .

How does TMEM170A regulate ER morphology and what are the antagonistic interactions with reticulon proteins?

TMEM170A functions as an ER-sheet-promoting protein that works in opposition to proteins that promote tubular ER formation, particularly the reticulon family. The molecular mechanism involves:

  • ER sheet promotion: Overexpression of TMEM170A induces proliferation of ER sheets, visualized as expanded CLIMP-63-positive ER and extensive well-organized sheet stacks decorated with membrane-bound ribosomes .

  • Antagonistic relationship with RTN4: TMEM170A physically interacts with RTN4, a member of the reticulon family that promotes tubular ER. The two proteins have opposing effects on ER membrane organization .

  • Functional antagonism: When TMEM170A is downregulated, tubular ER formation increases. Co-silencing of both TMEM170A and RTN4 rescues ER-related phenotypes, demonstrating their counterbalancing roles .

  • Balanced regulation: The ratio between TMEM170A and reticulon proteins appears to determine the balance between ER sheets and tubules, suggesting a rheostat-like mechanism for ER morphology control .

For zebrafish studies, researchers should investigate whether the same antagonistic relationship exists between zebrafish TMEM170A and reticulon family members, which would provide insight into the evolutionary conservation of this regulatory mechanism.

What is the relationship between TMEM170A expression and nuclear pore complex (NPC) formation?

TMEM170A plays a significant role in regulating nuclear pore complex formation and distribution:

  • NPC density regulation: Silencing TMEM170A decreases the density of NPCs in the nuclear envelope, as demonstrated by reduced immunofluorescence intensity of NPC markers (mAb414 and anti-ELYS antibodies) .

  • Nucleoporin levels: TMEM170A knockdown reduces cellular levels of various nucleoporins, including Nup62, Nup160, ELYS, and Pom121. Specifically, Nup62 protein levels decrease to approximately 29.5% of control levels following TMEM170A silencing .

  • Mechanistic link: The effect on NPCs appears to be connected to TMEM170A's role in ER sheet formation, as co-silencing of both TMEM170A and RTN4 rescues NPC-related phenotypes .

  • Quantitative assessment: Researchers quantified these effects through multiple methodologies, including:

    • Immunofluorescence intensity measurements

    • Western blot analysis of nucleoporin levels

    • Quantification of NPC density per unit area of nuclear envelope

These findings suggest that TMEM170A's role extends beyond ER morphology to influence nuclear envelope specialization. Zebrafish researchers should examine whether these functions are conserved and potentially develop transgenic reporter lines to visualize NPC dynamics in vivo.

What are the optimal handling and storage conditions for recombinant zebrafish TMEM170A protein?

For researchers working with recombinant Danio rerio TMEM170A protein, the following handling and storage conditions are recommended:

  • Storage buffer: The protein is typically provided in Tris-based buffer with 50% glycerol, optimized specifically for TMEM170A stability .

  • Storage temperature:

    • Long-term storage: -20°C or -80°C

    • Working aliquots: 4°C for up to one week

  • Stability considerations:

    • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

    • Prepare small working aliquots to minimize freeze-thaw cycles

  • Quantity considerations: Commercial preparations typically provide 50 μg, though other quantities may be available upon request .

When designing experiments with recombinant TMEM170A, researchers should conduct preliminary studies to determine optimal protein concentrations for their specific application, whether for antibody production, protein-protein interaction studies, or functional assays.

What imaging techniques are most effective for analyzing TMEM170A-induced changes in ER morphology?

Multiple complementary imaging approaches are recommended for comprehensive analysis of TMEM170A's effects on ER morphology:

  • Confocal fluorescence microscopy:

    • Effective for visualizing co-localization of TMEM170A with ER markers

    • Use markers for different ER domains: calnexin (general ER), RTN4 (tubular ER), and CLIMP-63 (ER sheets)

    • Enables quantification of changes in ER marker distribution patterns

  • Transmission electron microscopy (TEM):

    • Provides ultrastructural detail necessary to distinguish between tubular and sheet ER

    • Essential for visualizing nuclear envelope invaginations and ER reorganization

    • Allows visualization of connections between nuclear envelope and peripheral ER

  • 3D electron tomography:

    • Crucial for understanding the three-dimensional organization of ER structures

    • Enables differentiation between true sheet structures and tubules viewed in cross-section

    • Allows visualization of tubule-tubule fusion events and sheet formation

  • Live-cell imaging:

    • Using fluorescently tagged TMEM170A and ER markers

    • Enables temporal analysis of dynamic changes in ER morphology

    • Particularly valuable for capturing transitional states during ER remodeling

When analyzing imaging data, researchers should implement quantitative approaches to measure:

  • Ratio of sheets to tubules

  • Nuclear envelope surface area and volume

  • ER marker distribution patterns

  • ER-nuclear envelope connectivity

How can I design rescue experiments to confirm the specificity of TMEM170A knockdown phenotypes?

Rescue experiments are crucial for validating the specificity of TMEM170A knockdown phenotypes. Based on published approaches, the following design is recommended:

  • Experimental groups setup:

    • Control siRNA treatment

    • TMEM170A siRNA treatment

    • TMEM170A siRNA + rescue construct expression

    • Rescue construct expression alone (to assess potential overexpression artifacts)

  • Rescue construct design:

    • Use an expression vector containing TMEM170A coding sequence

    • Consider targeting 3'UTR with siRNA and expressing only the coding region for rescue

    • Include an epitope tag (FLAG, GFP, myc) for detection and differentiation from endogenous protein

  • Phenotypic assessment:

    • Examine multiple parameters: ER morphology, nuclear shape, NPC density, INM protein localization

    • Use both immunofluorescence and ultrastructural analysis

    • Quantify results to demonstrate statistical significance of rescue

  • Controls for interaction studies:

    • Include co-silencing experiments (e.g., TMEM170A and RTN4) to validate functional interactions

    • Assess protein-protein interactions through co-immunoprecipitation or proximity ligation assays

When analyzing rescue experiment data, results should demonstrate restoration of normal phenotypes in the key parameters affected by TMEM170A knockdown, specifically ER morphology, nuclear shape, and NPC formation.

How can contradictory results between different experimental systems be reconciled in TMEM170A research?

When facing contradictory results in TMEM170A research across different experimental systems, consider these methodological approaches:

  • System-specific differences assessment:

    • Compare protein expression levels of TMEM170A and its interaction partners across systems

    • Evaluate differences in membrane composition between cell types or organisms

    • Consider developmental stage-specific effects in zebrafish models

  • Technical validation strategies:

    • Use multiple knockdown/knockout approaches (siRNA, CRISPR, morpholinos)

    • Employ different tagged versions of TMEM170A to rule out tag interference

    • Validate antibody specificity through knockout controls

  • Dose-dependency analysis:

    • Establish dose-response relationships for TMEM170A expression levels and phenotypic outcomes

    • Create graduated expression systems using inducible promoters

    • Quantify relative expression of TMEM170A versus interaction partners like RTN4

  • Reconciliation approaches:

    • Identify common core phenotypes versus system-specific effects

    • Consider temporal dynamics—some contradictions may reflect different time points in a dynamic process

    • Investigate threshold effects where certain phenotypes only appear above/below critical expression levels

  • Data integration table: When presenting contradictory findings, organize results in a comprehensive comparison table:

ParameterSystem A ResultsSystem B ResultsPotential Explanation
ER morphologyIncreased sheetsNo changeDifferent RTN4:TMEM170A ratio
NPC densityDecreasedNo effectCell type-specific NPC regulation
Nuclear sizeEnlargedUnchangedDevelopmental stage differences

This structured approach helps identify patterns that might explain apparent contradictions and guide further experimental design to resolve discrepancies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.