Recombinant Danio rerio Transmembrane protein 177 (tmem177)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Transmembrane Protein 177 (Tmem177)

Recombinant Danio rerio Transmembrane protein 177 (Tmem177) refers to a protein produced through recombinant DNA technology, utilizing the genetic sequence of the Tmem177 gene from the zebrafish (Danio rerio). Tmem177 is a transmembrane protein, meaning it spans the cell membrane, and it is involved in various cellular processes . Research indicates that Tmem177 plays a crucial role in the biogenesis of cytochrome c oxidase (COX2), a key component of the mitochondrial respiratory chain .

Key Features of Tmem177

  • Gene Origin: Danio rerio (zebrafish) .

  • Protein Type: Transmembrane protein .

  • Molecular Function: Involved in the maturation of cytochrome c oxidase subunit II (MT-CO2/COX2) .

  • Role in Cytochrome c Oxidase Assembly: Tmem177 is associated with COX20 and is crucial for the stabilization of newly synthesized COX2 .

Functional Role and Significance

Tmem177 is integral to the early stages of COX2 maturation and is essential for stabilizing COX20, which is vital for the assembly of cytochrome c oxidase . Cytochrome c oxidase is a critical enzyme complex in the mitochondrial respiratory chain, responsible for generating ATP, the cell's primary energy currency .

  • Association with COX20: Tmem177 interacts with COX20, a scaffold protein in the inner mitochondrial membrane that recruits metallochaperones for copper delivery to the CuA-site of COX2 .

  • Impact on COX2 Stability: Studies suggest that Tmem177 influences the stability and turnover of COX2 .

  • Role in COX2 Assembly: Tmem177 promotes the assembly of COX2 at the CuA-site formation level .

Research Findings

Research has shown that the levels of Tmem177 directly affect the abundance of COX20, influencing the levels of COX2 . An imbalance in Tmem177 can cause newly synthesized COX2 to accumulate in a COX20-associated state .

"Our data shows that by unbalancing the amount of TMEM177, newly synthesized COX2 accumulates in a COX20-associated state" .

Experimental Methods Used in Tmem177 Studies

  1. Cell Culturing: HEK293T and HEK293 cells were cultured in DMEM media supplemented with fetal bovine serum .

  2. Quantitative Mass Spectrometry: Used to define COX20 interaction partners and identify Tmem177 .

  3. Bioinformatics Analysis: Prediction of transmembrane spans using TMpred and mitochondrial targeting sequence prediction via MitoProt Server .

  4. Protease Protection Analyses: Used to assess the membrane topology of TMEM177 .

Data Table: Tmem177 Overview

FeatureDescription
Protein NameRecombinant Danio rerio Transmembrane protein 177 (Tmem177)
OrganismDanio rerio (zebrafish)
FunctionInvolved in the maturation and stabilization of cytochrome c oxidase subunit II (COX2) and interacts with COX20
Cellular LocalizationMitochondria, inner mitochondrial membrane
Role in COX2 BiogenesisPromotes the assembly of COX2 at the level of CuA-site formation and influences COX2 stability and turnover
Experimental EvidenceIdentified through quantitative mass spectrometry as a COX20 interaction partner; membrane topology assessed by protease protection analyses
Bioinformatics PredictionTransmembrane spans predicted by TMpred; mitochondrial targeting sequence predicted by MitoProt Server

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
tmem177; zgc:73384; Transmembrane protein 177
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem177
Target Protein Sequence
MSSRFLKISVFIQKYRTPLLLIGCGGVFSANIFYHIFPDHTYKKVYQAWHKGEPASLSEK LQNIFQEVLKDSSISTSGNFSAFAAFGFHPVGAGVPWLPSGAQIGIPANFNSSTADLEGI TNRTILINGKELEWDSDSGVALKNSLVFSLEAQKFAIAREVARLGSGGPILHAAVAPVCL AGACVYSVALKQIFRFQAGSIIFRGVVNLLSLGLGVMTYVLAADSVSQWLDYRSDRRAAG LSRDYAKGGLEFYEKILTRNKTLRSLMGQKGEEMYAPSGNLFPAHLLQLRHATYTSRRDR ILNLLKNENV
Uniprot No.

Target Background

Function
This protein plays a crucial role in the initial stages of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation. It is essential for the stabilization of COX20 and the newly synthesized MT-CO2/COX2 protein.
Database Links

KEGG: dre:556875

STRING: 7955.ENSDARP00000091517

UniGene: Dr.3515

Protein Families
TMEM177 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of Danio rerio TMEM177?

Danio rerio TMEM177 is a full-length transmembrane protein consisting of 310 amino acids. It is encoded by the tmem177 gene (also known by ORF name zgc:73384) . The protein appears to contain multiple transmembrane domains, consistent with its function in membranous organelles. It likely possesses a specific topology that facilitates its role in protein stabilization and maturation processes. The protein is stored in research settings using a Tris-based buffer with 50% glycerol to maintain stability .

What is the complete amino acid sequence of Danio rerio TMEM177?

The full amino acid sequence of Danio rerio TMEM177 is:
MSSRFLKISVFIQKYRTPLLLIGCGGVFSANIFYHIFPDHTYKKVYQAWHKGEPASLSEKLQNIFQEVLKDSSISTSGNFSAFAAFGFHPVGAGVPWLPSGAQIGIPANFNSSTADLEGITNRTILINGKELEWDSDSGVALKNSLVFSLEAQKFAIAREVARLGSGGPILHAAVAPCLAGACVYSVALKQIFRFQAGSIIFRGVVNLLSLGLGVMTYVLAADSVSQWLDYRSDRRAAGGLSRDYAKGGLEFYEKILTRNKTLRSLMGQKGEEMYAPSGNLFPAHLLQLRHATYTSRRDRILNLLKNENV

This sequence information is essential for researchers designing experimental approaches such as antibody production, recombinant expression systems, or mutational analyses.

What is the primary function of TMEM177 in zebrafish cellular physiology?

TMEM177 plays a critical role in the early steps of cytochrome c oxidase subunit II (MT-CO2/COX2) maturation and is required for the stabilization of both COX20 and the newly synthesized MT-CO2/COX2 protein . This function positions TMEM177 as an important factor in mitochondrial respiratory chain assembly and function. Its role in stabilizing these components suggests it may serve as a chaperone or assembly factor that ensures proper incorporation of COX2 into the cytochrome c oxidase complex, which is essential for cellular respiration and energy production.

How does TMEM177 interact with the mitochondrial respiratory chain assembly pathway?

Based on its functional role, TMEM177 likely participates in a coordinated assembly pathway for respiratory chain complexes. Researchers should investigate its temporal involvement in cytochrome c oxidase assembly, examining whether it acts as an early assembly factor or participates in later maturation steps. Co-immunoprecipitation studies combined with mass spectrometry would help identify the complete interactome of TMEM177 during COX assembly. Additionally, researchers should explore whether TMEM177 functions exclusively in the COX2 maturation pathway or has broader roles in respiratory complex assembly.

How is TMEM177 expression regulated during zebrafish development and under different physiological conditions?

This represents an important research direction not fully addressed in the available literature. Researchers should conduct developmental expression profiling using techniques such as qRT-PCR, in situ hybridization, and immunohistochemistry to map temporal and spatial expression patterns of tmem177 throughout zebrafish development. Additionally, examining expression under conditions that challenge mitochondrial function (hypoxia, metabolic stress, temperature changes) would reveal potential regulatory mechanisms. Promoter analysis and chromatin immunoprecipitation could identify transcription factors that regulate tmem177 expression.

What are the optimal storage and handling conditions for recombinant Danio rerio TMEM177?

For optimal storage, recombinant TMEM177 should be kept at -20°C for regular use and -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability . To minimize degradation, researchers should avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week . When designing experiments, researchers should consider the buffer composition when introducing the protein into experimental systems to prevent compatibility issues with assay reagents.

What expression systems are most effective for producing functional recombinant TMEM177?

While the search results don't explicitly address optimal expression systems, researchers working with transmembrane proteins like TMEM177 should consider eukaryotic expression systems that can properly process membrane proteins. Insect cell (Sf9, High Five) or mammalian cell (HEK293, CHO) expression systems typically provide appropriate post-translational modifications and membrane insertion machinery. When expressing in E. coli, specialized strains designed for membrane protein expression (such as C41/C43) combined with solubilization tags (SUMO, MBP) may improve yield and solubility. Codon optimization for the expression host should be employed to maximize protein production.

What functional assays can effectively measure TMEM177's activity in COX2 maturation?

Researchers should develop assays that directly measure TMEM177's effect on COX2 stability and incorporation into the cytochrome c oxidase complex. This could include pulse-chase experiments tracking COX2 half-life in the presence or absence of TMEM177, blue native PAGE to assess complex assembly, and measurement of cytochrome c oxidase activity using spectrophotometric methods. Additionally, oxygen consumption rate measurements using technologies like Seahorse XF analyzers would provide functional readouts of mitochondrial respiration that could be correlated with TMEM177 activity levels.

What phenotypes emerge from tmem177 knockout or knockdown in zebrafish models?

Though not explicitly covered in the search results, researchers investigating tmem177 function should generate knockout or knockdown models using CRISPR-Cas9 or morpholino approaches. Based on its role in cytochrome c oxidase assembly , predicted phenotypes might include:

  • Reduced cytochrome c oxidase activity

  • Decreased oxygen consumption rates

  • Metabolic shifts toward glycolysis

  • Growth retardation or developmental delays

  • Tissue-specific effects in high-energy demanding organs (heart, brain, muscle)

  • Potential embryonic lethality if the function is essential

Detailed phenotypic analysis should include mitochondrial morphology assessment using electron microscopy and mitochondrial membrane potential measurements.

How does the function of TMEM177 compare to other transmembrane proteins involved in mitochondrial biology?

Researchers should conduct comparative analyses between TMEM177 and other transmembrane proteins involved in mitochondrial function, particularly those associated with respiratory chain assembly. This would include proteins like COX20, COX18, and other assembly factors. Functional complementation studies could determine whether these proteins have overlapping or distinct roles. Bioinformatic analysis of evolutionary conservation across these proteins could reveal shared functional domains that have been maintained throughout vertebrate evolution.

Can TMEM177 function be modulated pharmacologically, and what would be the physiological consequences?

This represents an unexplored research direction where investigators could screen for small molecules that modulate TMEM177 activity or stability. High-throughput approaches using TMEM177 protein levels or cytochrome c oxidase assembly as readouts could identify potential modulators. Given its role in energy metabolism, such compounds might have applications in addressing mitochondrial dysfunction. Researchers should examine both enhancement and inhibition of TMEM177 function to fully understand its therapeutic potential.

How conserved is TMEM177 structure and function across vertebrate species?

Researchers should conduct comparative genomic and proteomic analyses to evaluate TMEM177 conservation across vertebrate lineages. Multiple sequence alignment would identify highly conserved residues that likely correspond to functionally important regions. Phylogenetic analysis could reveal whether TMEM177 emerged early in vertebrate evolution and maintained its function or underwent functional diversification. Cross-species complementation experiments (e.g., testing if human TMEM177 can rescue zebrafish tmem177 mutants) would provide functional evidence of evolutionary conservation.

What can zebrafish TMEM177 studies reveal about human mitochondrial diseases?

Given that mitochondrial disorders often affect cytochrome c oxidase function, zebrafish TMEM177 research could provide valuable insights into human disease mechanisms. Researchers should identify human mitochondrial diseases with COX assembly defects and investigate whether TMEM177 dysfunction contributes to these conditions. Zebrafish models expressing human disease-associated TMEM177 variants could serve as in vivo systems for studying pathogenic mechanisms and testing potential therapeutic approaches. This translational aspect represents an important application of basic TMEM177 research.

How does TMEM177 differ from TMEM47 in structure and function within zebrafish?

While both are transmembrane proteins in zebrafish, TMEM177 and TMEM47 have distinct functions. TMEM177 is involved in cytochrome c oxidase maturation , while TMEM47 functions as an interferon-negative regulator during viral infections by interacting with MAVS and STING in an autophagy-lysosome-dependent manner . Researchers should perform comparative structural analysis between these proteins to understand how different transmembrane architectures support their specialized functions. Despite both being transmembrane proteins, their divergent roles highlight the functional diversity within this protein class in zebrafish.

What is the potential for using TMEM177 as a biomarker for mitochondrial dysfunction in experimental models?

Given its role in cytochrome c oxidase assembly, altered TMEM177 expression or localization could potentially serve as an indicator of mitochondrial stress or dysfunction. Researchers should investigate whether TMEM177 levels change in response to various mitochondrial stressors and whether these changes correlate with functional outcomes. Developing antibodies or reporter systems that can track TMEM177 in live zebrafish models would facilitate its use as a biomarker in experimental settings.

How does TMEM177 function integrate with broader cellular stress response pathways?

Mitochondrial function is interconnected with multiple cellular stress response systems. Researchers should investigate potential connections between TMEM177 and pathways such as the unfolded protein response, mitochondrial unfolded protein response, and oxidative stress responses. This would involve examining TMEM177 expression and function under various stress conditions and in models where stress response pathways have been experimentally manipulated.

What implications does TMEM177 function have for understanding zebrafish as a model organism in nutrition studies?

While primarily involved in mitochondrial function, TMEM177's role in energy metabolism makes it relevant to nutrition research using zebrafish models. Recent work has emphasized the importance of standardizing macronutrient sources in zebrafish studies to achieve scientific reproducibility . Researchers should investigate whether dietary manipulations affect TMEM177 expression or function, particularly in studies examining single cell protein as alternative nutrient sources . This would connect molecular mechanisms to broader physiological adaptation in nutrition research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.