Recombinant Danio rerio Transmembrane protein 178 (tmem178)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
tmem178a; tmem178; zgc:153181; Transmembrane protein 178A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-301
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem178a
Target Protein Sequence
IFTDHWYETDTRRHKENCDQYGSESNDQKNREMPIYHLPLVDSGNAKRNLALMKPIHVGS REEELLENWRAILGMGILETECGRPLFSTYSGLWRKCYFQGMDRDIDKLILKGIAERCTS VKYHFSQPIRLRNIPLNLTRTIQQDEWHLLHLRRITAGFLGMAAAVMLCGSIVAAVGFFW EESLTQHVSGLLFLMAGIFCTISLCTYAASVSYDLSRNPPFIYGLPSDVDHGYGWSIFCA WVSLGLTVASGCICTTYPFLSRTKALRSKTARESSV
Uniprot No.

Target Background

Function
May function as a negative regulator of osteoclast differentiation.
Database Links
Protein Families
TMEM178 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the primary functions of tmem178 in zebrafish?

Based on current research, tmem178 in zebrafish primarily functions as:

  • A negative regulator of calcium signaling pathways, particularly through interaction with store-operated calcium entry (SOCE) components

  • A modulator of inflammatory responses, where it negatively regulates IL-1β production through inhibition of SOCE-driven NLRP3 inflammasome activation

  • A regulator of osteoclast differentiation through controlling calcium-dependent NFATc1 induction

This protein appears to be evolutionarily conserved across vertebrates, with the human ortholog (TMEM178A) showing similar functional characteristics in calcium regulation and inflammatory control .

Why is zebrafish (Danio rerio) a suitable model for studying tmem178 function?

Zebrafish offers multiple advantages as a model organism for studying tmem178:

  • Genetic and functional conservation: Zebrafish tmem178 shares significant homology with human TMEM178A, making it relevant for translational research

  • Transparency: Zebrafish embryos are transparent, allowing for in vivo visualization of labeled proteins and cellular processes

  • Rapid development: Zebrafish have a short life cycle and produce numerous offspring (~300 eggs/week), enabling large-scale and time-efficient studies

  • Versatility: Zebrafish can be used to model various human conditions, including inflammatory disorders and developmental abnormalities that may involve tmem178

  • Genomic tools: Well-characterized genome with readily available genetic manipulation techniques makes it ideal for studying gene function

Furthermore, zebrafish have gained momentum as experimental models for simulating neurological disorders and craniofacial deformities, areas where transmembrane proteins like tmem178 may play important roles .

What are the optimal conditions for expressing and purifying recombinant Danio rerio tmem178?

The optimal expression and purification protocol for recombinant Danio rerio tmem178 involves:

Expression System:

  • E. coli is the most commonly used expression system for recombinant tmem178

  • The protein should be expressed with an N-terminal His tag to facilitate purification

Purification Method:

  • Harvest and lyse E. coli cells expressing the protein

  • Perform affinity chromatography using Ni-NTA resin to capture the His-tagged protein

  • Wash extensively to remove non-specifically bound proteins

  • Elute with imidazole-containing buffer

  • Perform SDS-PAGE analysis to confirm purity (should be >90%)

Storage Conditions:

  • Store as a lyophilized powder at -20°C/-80°C for long-term storage

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Aliquot for single use to avoid repeated freeze-thaw cycles

The purity should be confirmed using SDS-PAGE, and the protein should be greater than 90% pure for experimental applications .

How can researchers effectively study tmem178's interaction with calcium signaling pathways?

To investigate tmem178's interaction with calcium signaling pathways, researchers should employ these methodological approaches:

1. Calcium Imaging Techniques:

  • Use fluorescent calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium levels in wild-type vs. tmem178-deficient cells

  • Employ real-time confocal microscopy to visualize calcium fluxes in response to stimuli

2. Store-Operated Calcium Entry (SOCE) Analysis:

  • Deplete ER calcium stores using thapsigargin or ionomycin

  • Measure subsequent calcium influx in the presence or absence of extracellular calcium

  • Compare SOCE activation between wild-type and tmem178-deficient cells

3. Co-immunoprecipitation Studies:

  • Express tagged versions of tmem178 (e.g., HA-tagged) and potential interacting partners (e.g., Stim1-Myc)

  • Perform co-immunoprecipitation under various conditions (resting, calcium store depletion)

  • Analyze interactions by western blotting

4. CRISPR-Cas9 Gene Editing:

  • Generate tmem178 knockout or knock-in zebrafish lines

  • Analyze calcium dynamics in various tissues and developmental stages

  • Perform calcium-dependent functional assays

5. Subcellular Localization:

  • Use immunofluorescence to determine the subcellular localization of tmem178 (shown to reside in the ER but not plasma membrane in mature osteoclasts)

  • Perform co-localization studies with known ER proteins and calcium channels

Research has shown that Tmem178 interacts with Stim1 (an ER calcium sensor) but not with IP3R isoforms or Stim2, suggesting a specific role in modulating SOCE-dependent calcium signaling .

What experimental approaches are recommended for investigating tmem178's role in inflammatory responses?

For studying tmem178's role in inflammatory responses, researchers should consider these experimental approaches:

1. Inflammasome Activation Assays:

  • Isolate bone marrow-derived macrophages (BMDMs) from wild-type and tmem178-deficient zebrafish

  • Stimulate with LPS (priming) followed by nigericin (NLRP3 inflammasome activation)

  • Assess caspase-1 activation by flow cytometry or western blotting

  • Measure IL-1β secretion by ELISA

2. Calcium Chelation and SOCE Inhibition:

  • Culture cells in calcium-free media or with calcium chelators (BAPTA)

  • Use SOCE inhibitors like 2-Aminoethoxydiphenyl borate (2-APB)

  • Determine whether calcium modulation affects inflammasome activation in tmem178-deficient cells

3. Mitochondrial Function Assessment:

  • Measure oxidative respiration using Seahorse analyzer

  • Quantify mitochondrial reactive oxygen species (mtROS) using specific dyes

  • Assess mitochondrial damage using indicators of membrane potential

  • Compare mitochondrial parameters between wild-type and tmem178-deficient cells

4. Gene Expression Analysis:

  • Perform RNA-seq or microarray analysis on macrophages from wild-type vs. tmem178-deficient fish

  • Focus on inflammatory pathways and inflammasome components

  • Validate findings with RT-qPCR

5. In Vivo Inflammation Models:

  • Generate tmem178-deficient zebrafish lines

  • Challenge with inflammatory stimuli (LPS injection)

  • Measure inflammatory markers and cytokine production

  • Assess response to inflammasome inhibitors

Research has shown that Tmem178-deficient macrophages produce elevated IL-1β compared to wild-type cells, and inhibition of inflammasome or IL-1 neutralization prolongs survival in disease models . This suggests tmem178 functions as a negative regulator of inflammatory responses.

How can researchers differentiate between the functions of tmem178 and other transmembrane proteins (like tmem53) in zebrafish?

To differentiate between the functions of tmem178 and other transmembrane proteins such as tmem53 in zebrafish, researchers should employ the following approaches:

1. Comparative Sequence and Structure Analysis:

  • Perform multiple sequence alignments to identify conserved and divergent domains

  • Predict protein structure using bioinformatics tools

  • Identify functional motifs specific to each protein family

2. Specific Gene Knockdown/Knockout Studies:

  • Use morpholinos or CRISPR-Cas9 to selectively target tmem178 or tmem53

  • Compare phenotypes resulting from single vs. double knockdowns

  • Perform rescue experiments with wild-type or mutant constructs

3. Domain Swapping Experiments:

  • Create chimeric proteins by swapping domains between tmem178 and tmem53

  • Express these in knockout backgrounds to determine which domains confer specific functions

  • Analyze functional recovery in domain-specific mutants

4. Tissue-Specific Expression Analysis:

  • Perform in situ hybridization to map expression patterns during development

  • Use transgenic reporter lines to visualize protein localization in different tissues

  • Compare expression timing and localization between tmem178 and tmem53

5. Interactome Mapping:

  • Perform yeast two-hybrid or BioID experiments to identify protein-protein interactions

  • Compare the interacting partners of tmem178 vs. tmem53

  • Validate key interactions using co-immunoprecipitation and functional assays

While tmem178 has been shown to interact with Stim1 and regulate SOCE-dependent calcium signaling , tmem53 may have distinct functions and interaction partners . Understanding these differences is crucial for developing targeted experimental approaches.

How should researchers interpret contradictory data regarding tmem178 function across different model systems?

When facing contradictory data about tmem178 function across different model systems, researchers should consider:

1. Evolutionary Divergence Analysis:

  • Compare protein sequence homology across species (human, mouse, zebrafish)

  • Identify species-specific domains that might explain functional differences

  • Consider the evolutionary context of calcium signaling pathways

2. System-Specific Variables:

  • Analyze differences in experimental conditions (temperature, pH, ion concentrations)

  • Consider cell/tissue-specific expression patterns and potential compensatory mechanisms

  • Evaluate the maturity of the model system (embryonic vs. adult zebrafish have different immune system capacities)

3. Statistical Rigor Assessment:

  • Evaluate sample sizes and statistical power across studies

  • Consider biological vs. technical replicates

  • Assess whether appropriate controls were included

4. Methodological Standardization:

  • Standardize protein expression and purification protocols

  • Use consistent activation protocols for calcium signaling and inflammasome studies

  • Develop unified assay systems to minimize technique-based variations

5. Integrated Data Analysis:

  • Perform meta-analysis of available data

  • Develop computational models to reconcile contradictory findings

  • Identify parameters that could explain divergent results

For example, while tmem178 knockout in mice showed reduced bone mass and increased osteoclast activity , its function in zebrafish inflammation may differ due to the aquatic environment and species-specific adaptations . Recognizing these context-dependent functions is crucial for accurate interpretation.

What are the challenges in translating findings from zebrafish tmem178 studies to human disease models?

Translating findings from zebrafish tmem178 studies to human disease models presents several challenges:

1. Genetic and Functional Divergence:

  • Human TMEM178A shares homology with zebrafish tmem178 but may have evolved species-specific functions

  • Gene duplication events may have created paralogs with partially redundant functions

  • Different regulatory mechanisms may control expression in humans vs. zebrafish

2. Physiological System Differences:

  • Zebrafish are poikilothermic (cold-blooded) while humans are homeothermic

  • Immune system components differ between species (zebrafish lack some mammalian immune cell types)

  • Calcium homeostasis mechanisms may have species-specific adaptations

3. Disease Model Limitations:

  • Some human diseases lack perfect zebrafish equivalents

  • Zebrafish models may not fully recapitulate complex human inflammatory disorders

  • Early life stage studies in zebrafish embryos may not reflect adult disease states

4. Pharmacological Considerations:

  • Drug metabolism differs between species

  • Target specificity of compounds may vary

  • Delivery routes and bioavailability present challenges in translation

5. Technical Translation Barriers:

  • Methods optimized for zebrafish may require substantial modification for human studies

  • Clinical samples have greater heterogeneity than laboratory models

  • Ethical constraints limit certain experimental approaches in human studies

Researchers have found that TMEM178 levels are reduced in monocytes from systemic juvenile idiopathic arthritis (sJIA) patients while IL-1B shows increased levels , supporting functional conservation but highlighting the need for careful translation between model systems.

How can researchers leverage tmem178's role in calcium signaling to develop potential therapeutic approaches?

Researchers can leverage tmem178's role in calcium signaling for therapeutic development through:

1. Target Identification and Validation:

  • Map the functional domains of tmem178 that interact with Stim1 and regulate SOCE

  • Identify small molecules that can modulate these interactions

  • Validate targets using mutational analysis and functional assays

2. Biomarker Development:

  • Assess tmem178 expression levels as potential biomarkers for inflammatory diseases

  • Correlate expression levels with disease severity and treatment response

  • Develop diagnostic tools to measure tmem178 activity in patient samples

3. Pathway-Specific Therapeutic Approaches:

  • Design compounds that enhance tmem178 expression or activity to reduce inflammation

  • Develop inhibitors of downstream effectors in tmem178-deficient conditions

  • Create peptide mimetics of the Stim1-binding domain to block excessive SOCE

4. Genetic Therapy Strategies:

  • Design gene therapy approaches to restore tmem178 expression in deficient cells

  • Develop CRISPR-based methods to correct mutations affecting tmem178 function

  • Explore RNA therapeutics to modulate tmem178 expression

5. Combinatorial Treatment Approaches:

  • Target multiple components of the calcium signaling pathway

  • Combine tmem178-targeted therapies with existing anti-inflammatory drugs

  • Develop personalized treatment regimens based on tmem178 expression profiles

Research has shown that inhibition of inflammasome or IL-1 neutralization prolongs survival in tmem178-deficient mouse models of cytokine storm syndrome (CSS) , suggesting that targeting this pathway could benefit patients with reduced TMEM178 expression.

What are the most promising unexplored aspects of Danio rerio tmem178 research?

The most promising unexplored aspects of Danio rerio tmem178 research include:

1. Developmental Functions:

  • Investigate tmem178's role in zebrafish embryonic development

  • Map expression patterns throughout developmental stages

  • Determine if tmem178 participates in calcium-dependent developmental processes

2. Neural Function:

  • Explore tmem178's role in neuronal calcium signaling

  • Investigate potential functions in synaptic plasticity and neurotransmission

  • Determine whether tmem178 deficiency affects learning or behavior in zebrafish models

3. Tissue-Specific Regulatory Mechanisms:

  • Characterize tissue-specific enhancers controlling tmem178 expression

  • Identify transcription factors that regulate tmem178 in different cell types

  • Develop tissue-specific knockout models to dissect context-dependent functions

4. Interaction with Environmental Stressors:

  • Study how environmental contaminants affect tmem178 expression and function

  • Investigate whether toxins like methylmercury alter tmem178-dependent calcium signaling

  • Examine temperature-dependent effects on tmem178 activity in poikilothermic zebrafish

5. Evolution of Calcium Regulatory Mechanisms:

  • Compare tmem178 function across evolutionary distant vertebrates

  • Identify conserved versus divergent aspects of calcium regulation

  • Investigate how evolutionary pressures shaped tmem178's function in aquatic versus terrestrial vertebrates

Given tmem178's role in calcium signaling and inflammation regulation , these unexplored areas could yield valuable insights into basic biological processes and potential therapeutic applications.

How can advanced genomic techniques be applied to better understand tmem178 regulation and function in zebrafish?

Advanced genomic techniques that can enhance our understanding of tmem178 regulation and function include:

1. Single-Cell RNA Sequencing:

  • Profile tmem178 expression at single-cell resolution across tissues

  • Identify cell populations with high or low tmem178 expression

  • Discover co-expressed genes that may function in the same pathways

2. CRISPR Screening Approaches:

  • Perform genome-wide CRISPR screens to identify genes that modulate tmem178 function

  • Create libraries of tmem178 domain mutants to map functional regions

  • Develop pooled CRISPR activation/repression screens to identify upstream regulators

3. Chromatin Accessibility and Interaction Analysis:

  • Use ATAC-seq to map open chromatin regions near the tmem178 locus

  • Perform Hi-C or similar techniques to identify long-range chromatin interactions

  • Identify enhancers and silencers that regulate tmem178 expression

4. Ribosome Profiling:

  • Assess translational efficiency of tmem178 mRNA

  • Identify potential upstream open reading frames or regulatory elements

  • Compare translational regulation across tissues and conditions

5. Integrative Multi-Omics Approaches:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Develop network models of tmem178-associated pathways

  • Use systems biology approaches to predict context-dependent functions

For example, researchers have used microarray analysis to study gene expression changes in zebrafish brain following methylmercury exposure , similar approaches could be applied to understand how environmental factors influence tmem178 expression and function.

What interdisciplinary approaches could enhance our understanding of tmem178's role in disease processes?

Interdisciplinary approaches to enhance understanding of tmem178's role in disease processes include:

1. Computational Biology and Artificial Intelligence:

  • Develop machine learning models to predict tmem178 interactions

  • Use molecular dynamics simulations to model protein structure and function

  • Create network analysis tools to position tmem178 within disease pathways

2. Biophysics and Structural Biology:

  • Determine the three-dimensional structure of tmem178 using cryo-EM or X-ray crystallography

  • Study conformational changes upon calcium binding or protein-protein interactions

  • Design structure-based therapeutic molecules

3. Systems Immunology:

  • Map tmem178's role in immune cell signaling networks

  • Investigate cross-talk between calcium signaling and other inflammatory pathways

  • Develop integrated models of inflammation incorporating tmem178 function

4. Clinical Translational Research:

  • Correlate tmem178 expression in patient samples with disease outcomes

  • Develop humanized zebrafish models expressing patient-derived tmem178 variants

  • Test therapeutic strategies in zebrafish before moving to mammalian models

5. Environmental Toxicology:

  • Study how environmental contaminants affect tmem178 expression and function

  • Investigate whether tmem178 mediates toxicant-induced calcium dysregulation

  • Develop zebrafish-based screening platforms for compounds that alter tmem178 activity

Research has shown that downregulation of TMEM178 levels may represent a new biomarker to identify patients who could benefit from receiving drugs targeting inflammasome signaling . Integrating insights from multiple disciplines could accelerate the development of such therapeutic approaches.

How might tmem178 function in zebrafish inform our understanding of calcium-dependent disorders in humans?

The study of tmem178 function in zebrafish can inform our understanding of calcium-dependent disorders in humans through:

1. Conserved Calcium Signaling Mechanisms:

  • Zebrafish tmem178 interacts with Stim1 to regulate SOCE, similar to human TMEM178A

  • This conservation allows for modeling of calcium dysregulation disorders

  • Findings may apply to conditions like store-operated calcium entry-associated regulatory factor (SCARF) deficiency

2. Inflammatory Disease Models:

  • Tmem178 negatively regulates inflammasome activation and IL-1β production

  • Zebrafish models can inform understanding of cytokine storm syndrome and autoinflammatory disorders

  • Research may reveal novel therapeutic targets for conditions like systemic juvenile idiopathic arthritis (sJIA)

3. Bone Pathology Insights:

  • Tmem178 regulates osteoclast differentiation through calcium-dependent mechanisms

  • Zebrafish models can inform understanding of bone disorders

  • Findings may be relevant to conditions like osteoporosis and inflammatory bone loss

4. Neurological Disorder Applications:

  • Calcium dysregulation plays a role in many neurological disorders

  • Zebrafish models can reveal how tmem178 affects neuronal calcium homeostasis

  • Research may inform understanding of neurodegenerative diseases with calcium involvement

5. Drug Discovery Platform:

  • Zebrafish provide a cost-effective in vivo screening platform

  • Compounds affecting tmem178 function can be tested for efficacy and toxicity

  • Successful candidates can progress to mammalian models and clinical studies

Studies have found that TMEM178 expression is reduced in monocytes from sJIA patients, correlating with increased IL-1B levels . This suggests that zebrafish research on tmem178 could have direct relevance to understanding and treating human inflammatory disorders.

Tmem178-Related Findings in Different ModelsZebrafishMouseHuman Cells
Subcellular LocalizationEndoplasmic reticulumEndoplasmic reticulumEndoplasmic reticulum
Key Interaction PartnerStim1 (predicted)Stim1 (confirmed)Stim1 (confirmed)
Effect on Calcium SignalingNegative regulator (predicted)Negative regulatorNegative regulator
Role in InflammationSuppresses IL-1β (predicted)Suppresses IL-1βSuppresses IL-1β
Disease RelevanceModel organismCSS, arthritissJIA, CSS
Expression Alteration in DiseaseUnder investigationDecreased in inflammationDecreased in sJIA

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.