Recombinant Danio rerio Transmembrane protein 179 (tmem179)

Shipped with Ice Packs
In Stock

Description

Introduction to Danio rerio Transmembrane Protein 179

Transmembrane protein 179 (tmem179) is a protein-coding gene found in the zebrafish (Danio rerio) genome. It belongs to the TMEM179 family, a group of proteins characterized by multiple membrane-spanning domains that are evolutionarily conserved across vertebrate species. The zebrafish model has become increasingly important in biomedical research due to its genetic similarity to humans, transparent embryos allowing for developmental visualization, and ease of genetic manipulation .

Recombinant Danio rerio tmem179 refers to the artificially synthesized version of this protein, typically produced through molecular cloning techniques where the gene's DNA sequence is inserted into expression vectors for subsequent protein production in laboratory settings. This recombinant form enables researchers to study the protein's structure, function, and potential applications in diverse biological systems and disease models.

The study of tmem179 in zebrafish provides valuable insights into both basic molecular biology and potential applications in neuroscience, as emerging evidence suggests roles for TMEM179 proteins in neural function across species. Despite its potential importance, detailed characterization of this protein remains limited, particularly in comparison to more extensively studied membrane proteins.

Gene Structure and Identification

The tmem179 gene in Danio rerio is identified by the Entrez Gene ID 100537383 and is classified as a protein-coding gene. Genomic analysis has revealed that zebrafish actually possess distinct versions of this gene, with tmem179aa (transmembrane protein 179a, genome duplicate A) being a well-characterized variant located on chromosome 20 . This gene duplication is consistent with the teleost-specific genome duplication event in the evolutionary history of zebrafish.

The gene was previously known simply as tmem179 or by the designation zgc:101058 before more precise nomenclature was established . The genomic organization of tmem179 in zebrafish reflects the complexity introduced by gene duplication events that are common in this species.

Transcriptional Variants and mRNA Expression

Multiple transcriptional variants of tmem179 have been identified in Danio rerio, including transcripts with the accession numbers XM_003200379.4 and XM_003200379.5 . These transcripts encode what has been described as either "transmembrane protein 179" or "transmembrane protein 179-like" products, reflecting some uncertainty in the precise classification of these proteins.

The tmem179 gene generates mRNA transcripts that undergo processing to form mature mRNAs for translation. One documented variant, tmem179-201, has been annotated through Ensembl analysis with a nucleotide length of 1,154 base pairs . Expression pattern analysis suggests that tmem179aa is expressed in female zebrafish, indicating potential sex-specific roles for this protein .

Evolutionary Conservation

Tmem179 exhibits notable evolutionary conservation across vertebrate species, suggesting functional importance. Comparative genomic analysis has identified orthologs in various species including humans (TMEM179), mice (Tmem179), rats (Tmem179), and other vertebrates . The table below illustrates the cross-species conservation of TMEM179 proteins:

SpeciesGene SymbolProtein Accession
Homo sapiens (human)TMEM179NP_001273318.1
Mus musculus (house mouse)Tmem179NP_849246.2
Rattus norvegicus (Norway rat)Tmem179NP_001119752.1
Danio rerio (zebrafish)tmem179NP_001003767.1
Danio rerio (zebrafish)LOC100537383XP_003200427.1
Xenopus tropicalis (tropical clawed frog)tmem179XP_002940764.1
Gallus gallus (chicken)TMEM179NP_001264830.1

This conservation pattern suggests that tmem179 likely plays a fundamental biological role that has been maintained throughout vertebrate evolution .

Subcellular Localization

Prediction analyses suggest that tmem179 is localized to cellular membranes, which is consistent with its classification as a transmembrane protein. By comparison with human TMEM179, which is predicted to be localized to the endoplasmic reticulum (ER), zebrafish tmem179 likely shares similar subcellular localization patterns .

The membrane localization is crucial for understanding potential functions, as membrane proteins often serve as channels, receptors, or structural components involved in cellular communication, transport, and signaling processes. The predicted four-transmembrane topology suggests potential roles in forming membrane complexes or channels.

Cloning and Expression Vectors

Recombinant expression of Danio rerio tmem179 involves cloning the gene's coding sequence into appropriate expression vectors. Commercial sources offer cDNA ORF clones derived from tmem179 with a nucleotide sequence length of 702 base pairs . These clones are typically delivered in standard expression vectors such as pcDNA3.1-C-(k)DYK or can be customized according to specific research requirements.

The clone identified with ID ODa22866 corresponds to sequences related to accession numbers XM_003200379.4 and XM_003200379.5, providing researchers with ready-to-use tools for expression studies . These commercially available resources facilitate the expression of recombinant tmem179 in various experimental systems.

Expression Systems and Purification

While the search results don't provide specific details about expression systems optimized for Danio rerio tmem179, typical approaches for recombinant membrane proteins include bacterial (E. coli), yeast (Pichia pastoris, Saccharomyces cerevisiae), insect cell (Sf9, Sf21), or mammalian cell expression systems. For membrane proteins like tmem179, eukaryotic expression systems are often preferred to ensure proper folding and post-translational modifications.

Purification of recombinant tmem179 would typically involve:

  1. Cell lysis under conditions that preserve membrane protein structure

  2. Solubilization using appropriate detergents

  3. Affinity chromatography utilizing fusion tags (such as His-tag, FLAG-tag, or DYK-tag)

  4. Size exclusion chromatography for final purification

For recombinant proteins, a purity of at least 85% as determined by SDS-PAGE is typically considered acceptable for most research applications, similar to standards mentioned for other recombinant proteins in the search results .

Potential Neurological Functions

The functional significance of tmem179 in Danio rerio is not yet fully characterized, but insights can be drawn from studies of its orthologs in other species. The human ortholog TMEM179 is believed to have functions in the nervous system, suggesting that zebrafish tmem179 may play similar roles .

Recent research indicates a potential connection between TMEM179 and protection against neurotoxicity. A study investigating arsenic-induced neurotoxicity found that N-acetylcysteine (NAC) antagonizes this toxicity through a mechanism involving TMEM179 by inhibiting oxidative stress in neural cells . This suggests that TMEM179 proteins may participate in neuroprotective pathways, potentially involving responses to oxidative stress.

The expression pattern of tmem179aa in female zebrafish organisms suggests possible sex-specific roles that warrant further investigation . This sexual dimorphism in expression could indicate functions related to reproduction or sex-specific physiological processes.

Relationship to Cellular Stress Responses

While not specifically studied in zebrafish, research involving TMEM179 in other models suggests a potential role in cellular stress responses. The connection to arsenic-induced neurotoxicity indicates that these proteins may be involved in pathways that respond to oxidative stress, mitochondrial dysfunction, or apoptotic signals .

The study mentioned in the search results demonstrated that arsenic exposure decreased cell viability, increased oxidative stress, caused mitochondrial dysfunction, and led to apoptosis in neural cells, with TMEM179 somehow involved in the protective mechanisms against these effects . This suggests that tmem179 in zebrafish might similarly participate in cellular defense mechanisms against environmental toxins or oxidative damage.

Research Tools and Resources

Several research tools are available for studying Danio rerio tmem179:

  1. cDNA ORF Clones: Commercial sources provide cDNA ORF clones of tmem179 that can be used for recombinant expression studies. These clones typically start at around $99.00 and are available in standard or customized vectors .

  2. Expression Vectors: The tmem179 coding sequence can be delivered in standard expression vectors such as pcDNA3.1+/C-(K)DYK or customized vectors based on research requirements .

  3. Genomic Resources: Databases such as ZFIN (Zebrafish Information Network) provide comprehensive information about the gene, including expression patterns, sequence data, and cross-species comparisons .

While not specifically mentioned for zebrafish tmem179, research on related proteins may utilize tools such as:

  1. Antibodies: Polyclonal and monoclonal antibodies against TMEM179 family proteins that might cross-react with the zebrafish ortholog .

  2. ELISA Kits: Enzyme-linked immunosorbent assay kits for detection and quantification of TMEM179 proteins .

Models for Functional Studies

Zebrafish provide an excellent model system for studying tmem179 function for several reasons:

  1. Genetic Tractability: Zebrafish are amenable to genetic manipulation techniques including CRISPR/Cas9 gene editing, morpholino knockdown, and transgenic approaches.

  2. Transparency: The transparent nature of zebrafish embryos allows for real-time visualization of developmental processes and protein localization using fluorescent tags.

  3. High-throughput Screening: Zebrafish embryos can be used for high-throughput drug screening, potentially identifying compounds that interact with or modulate tmem179 function.

  4. Neurodevelopmental Studies: Given the potential neurological functions of tmem179, zebrafish serve as valuable models for studying neural development and function in the context of this protein.

Functional Conservation

The conserved structure of TMEM179 proteins across species suggests functional conservation, though species-specific roles may also exist:

  1. Neurological Functions: Both human and zebrafish TMEM179 are implicated in neurological functions, suggesting conservation of this role across vertebrates .

  2. Subcellular Localization: The predicted membrane localization is consistent across species, suggesting similar subcellular roles .

  3. Gene Duplication in Zebrafish: The presence of multiple tmem179-related genes in zebrafish (such as tmem179aa) reflects the teleost-specific genome duplication and may indicate functional diversification or specialization in this species .

Knowledge Gaps and Research Limitations

Several significant knowledge gaps exist regarding Danio rerio tmem179:

  1. Functional Characterization: The precise biological function of tmem179 in zebrafish remains largely unknown, with much of our understanding inferred from limited studies in other species.

  2. Interaction Partners: The protein-protein interaction network of tmem179 has not been well characterized, limiting our understanding of its role in cellular pathways.

  3. Developmental Expression: Detailed information about the temporal and spatial expression patterns of tmem179 during zebrafish development is limited.

  4. Physiological Relevance: The importance of tmem179 for normal zebrafish physiology and development has not been thoroughly investigated through knockout or knockdown studies.

Future Research Directions

Future research on Danio rerio tmem179 could focus on several promising directions:

  1. Comprehensive Expression Analysis: Detailed characterization of tmem179 expression patterns during development and in different tissues using techniques such as in situ hybridization and RNA-seq.

  2. Functional Studies: Generation of tmem179 knockout or knockdown zebrafish models to assess phenotypic consequences and elucidate function.

  3. Protein Interaction Studies: Identification of interaction partners through techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling approaches.

  4. Structural Studies: Detailed structural analysis of recombinant tmem179 using techniques such as X-ray crystallography or cryo-electron microscopy to understand its three-dimensional organization.

  5. Disease Modeling: Investigation of tmem179 in the context of neurological disease models in zebrafish, particularly given its potential role in neuroprotection against toxicity .

  6. Comparative Studies: More detailed comparison with mammalian orthologs to understand evolutionary conservation and divergence of function.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
tmem179; si:dkey-85n7.1; zgc:101058; Transmembrane protein 179
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem179
Target Protein Sequence
MAVDNFLFGQCILYFLAFLFGFIAVVPLSENGDDFQGKCLLFTEGIWQNENMTMGKQRFI VEEWGPESSCRFITFVGIVSLILSAVQAWRTFFFLCKGHDDSLFHSFLNLLLSLLVLFVV FVAGTISSVGFSIWCDSVTENGAMPSSCEDLQDTDLELGVENSSFYDQFAIAQFGLWSAW LCWLGLTVLAFLKVYHNHRQQELLESLVQEKELLLGHPLQRSSYVYNRNAMI
Uniprot No.

Target Background

Database Links
Protein Families
TMEM179 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic genetic structure of tmem179 in Danio rerio?

Transmembrane protein 179 (tmem179) in Danio rerio is a protein-coding gene with the Entrez Gene ID 100537383. The gene encodes a transmembrane protein that is expressed in zebrafish . Based on current annotation data, the gene produces multiple transcript variants, with XM_003200379.4 and XM_003200379.5 representing two documented sequences that encode the same protein product (XP_003200427.1) . The complete open reading frame (ORF) of the zebrafish tmem179 gene spans 702 base pairs, encoding a functional protein that belongs to the transmembrane protein family .

How is tmem179 evolutionarily conserved across species?

Tmem179 demonstrates significant evolutionary conservation across multiple vertebrate species. The protein sequence reveals homology with transmembrane protein 179 found in:

SpeciesGene SymbolProtein Accession
Homo sapiens (human)TMEM179NP_001273318.1
Mus musculus (house mouse)Tmem179NP_849246.2
Rattus norvegicus (Norway rat)Tmem179NP_001119752.1
Gallus gallus (chicken)TMEM179NP_001264830.1
Danio rerio (zebrafish)tmem179NP_001003767.1
Xenopus tropicalis (tropical clawed frog)tmem179XP_002940764.1

This cross-species conservation suggests fundamental biological importance, with zebrafish tmem179 sharing key structural and potentially functional domains with mammalian counterparts . The protein family extends to invertebrate species as well, with related proteins identified in Drosophila melanogaster (CG13603) and Anopheles gambiae (AgaP_AGAP004210), indicating ancient evolutionary origins .

What expression systems are recommended for recombinant production of Danio rerio tmem179?

For recombinant expression of zebrafish tmem179, mammalian expression systems are typically preferred due to the protein's transmembrane nature and potential requirement for post-translational modifications. The optimized methodology includes:

  • Vector selection: pcDNA3.1-C-(k)DYK or equivalent mammalian expression vectors that provide appropriate promoters and selection markers

  • Cell line optimization: HEK293 or CHO cells are recommended for transmembrane protein expression

  • Transfection protocol: Lipid-based transfection reagents at 70-80% cell confluency

  • Expression verification: Western blot analysis using appropriate antibodies, such as goat polyclonal antibodies raised against specific peptide epitopes

The clone ID ODa22866 corresponds to validated expression constructs containing the tmem179 ORF, which can be directly utilized for recombinant protein production in appropriate expression systems .

How does tmem179 function in relation to the antiviral immune response in zebrafish?

While specific information on tmem179's role in antiviral immunity is limited, research on the related transmembrane protein TMEM33 in zebrafish provides valuable insights into potential functional mechanisms. TMEM33 has been identified as a negative regulator of virus-triggered interferon (IFN) induction through two distinct mechanisms :

  • Promotion of K48-linked ubiquitination of mitochondrial antiviral signaling protein (MAVS), leading to its degradation

  • Decrease in the kinase activity of TANK binding kinase 1 (TBK1), which reduces phosphorylation of MITA/IRF3

Experimental evidence demonstrates that TMEM33 localizes to the endoplasmic reticulum and directly interacts with RIG-I-like receptor (RLR) signaling cascades. Upon viral stimulation, tmem33 gene expression is significantly upregulated in zebrafish liver cells, suggesting induction as part of the antiviral response regulatory network . Knockdown experiments show that reducing TMEM33 levels increases interferon transcription, further supporting its role as a negative regulator of the antiviral response .

What are the critical functional domains of tmem179 essential for protein-protein interactions in immune signaling?

Structure-function analysis of the related TMEM33 protein identifies crucial transmembrane domains that may share functional significance with tmem179. Domain mapping experiments reveal:

DomainPositionFunctional Significance
N-terminal transmembrane domain 1 (TM1)N-terminal regionEssential for IFN suppression
Transmembrane domain 2 (TM2)Adjacent to TM1Necessary for complete IFN suppression activity
Cytoplasmic regionsBetween TM domainsPotential interaction sites with signaling components

Functional domain assays demonstrate that the N-terminal TM1 and TM2 regions are necessary for interferon suppression activity . These domains likely facilitate protein-protein interactions with immune signaling components, including potential interactions with MAVS and TBK1. For tmem179, similar transmembrane topology may indicate comparable functional domains, though specific experimental confirmation for tmem179 remains necessary.

What methodological approaches are recommended for studying tmem179 subcellular localization and trafficking?

To investigate subcellular localization and trafficking of tmem179, the following methodological approach is recommended:

  • Fluorescent protein tagging: Generate C-terminal or N-terminal GFP/RFP fusion constructs with tmem179 ORF, ensuring tag placement doesn't disrupt transmembrane domains

  • Confocal microscopy: Perform live-cell imaging in zebrafish cell lines transfected with fluorescent-tagged tmem179

  • Co-localization studies: Use established markers for cellular compartments (ER-Tracker, MitoTracker, etc.) to determine precise subcellular location

  • FRAP (Fluorescence Recovery After Photobleaching): Assess protein mobility and trafficking dynamics within membrane systems

  • Immunogold electron microscopy: For higher resolution localization using specific antibodies against tmem179

Based on studies of related proteins, tmem179 is likely localized to the endoplasmic reticulum, similar to TMEM33 which influences ER tubular structure and calcium homeostasis . Verification of tmem179's specific localization pattern is essential for understanding its functional significance in zebrafish cells.

What are the optimal conditions for expressing and purifying recombinant zebrafish tmem179 for structural studies?

For structural studies of recombinant zebrafish tmem179, a multi-step optimization protocol is recommended:

  • Expression system selection:

    • Insect cell systems (Sf9, High Five) for higher yields of membrane proteins

    • Mammalian expression systems for native post-translational modifications

    • E. coli systems with specialized strains (C41, C43) for preliminary constructs

  • Construct optimization:

    • Remove flexible regions identified by secondary structure prediction

    • Consider truncated constructs focusing on specific domains

    • Add purification tags (His6, FLAG) at termini less likely to interfere with folding

  • Purification strategy:

    • Membrane extraction using mild detergents (DDM, LMNG, or GDN)

    • Two-step affinity chromatography followed by size exclusion

    • Detergent exchange during purification for stability optimization

  • Stability screening:

    • Thermal shift assays to identify optimal buffer conditions

    • Limited proteolysis to identify stable domains

The validated clone ID ODa22866 can serve as the starting material for these optimization protocols, with expression verification performed using specific antibodies such as the affinity-purified goat polyclonal antibody raised against tmem179 peptide epitopes .

How can gene editing approaches be utilized to study tmem179 function in zebrafish models?

CRISPR-Cas9 gene editing provides a powerful approach for studying tmem179 function in zebrafish:

  • Guide RNA design:

    • Target exonic regions with high specificity scores

    • Design multiple gRNAs targeting different exons to increase success rate

    • Verify lack of off-target effects using bioinformatic prediction tools

  • Delivery method:

    • Microinjection of Cas9 protein with synthesized gRNAs into one-cell stage embryos

    • Alternative: injection of Cas9 mRNA with gRNAs for longer expression

  • Mutation verification:

    • High-resolution melting analysis (HRMA) for rapid screening

    • T7 endonuclease I assay for detecting indels

    • Targeted sequencing to confirm exact mutations

  • Phenotypic analysis:

    • Assess development and morphology during embryogenesis

    • Examine immune response to viral challenges by measuring interferon levels

    • Evaluate calcium homeostasis and ER morphology using fluorescent indicators

  • Rescue experiments:

    • Reintroduce wild-type or mutant tmem179 to validate phenotype specificity

    • Use tissue-specific promoters to address cell-autonomous effects

Given the potential role of tmem179 in immune regulation, as suggested by studies on TMEM33 , particular attention should be paid to immunological parameters and response to pathogen challenges in the gene-edited models.

What approaches are recommended for studying protein-protein interactions between tmem179 and potential binding partners?

To investigate protein-protein interactions involving tmem179, a multi-faceted approach is recommended:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged tmem179 in zebrafish cells

    • Perform IP with tag-specific antibodies followed by mass spectrometry

    • Validate interactions with specific antibodies against predicted partners

  • Proximity labeling techniques:

    • Generate BioID or TurboID fusion constructs with tmem179

    • Express in zebrafish cells and identify proximal proteins through biotin labeling

    • This approach is particularly valuable for transmembrane proteins with transient interactions

  • FRET/BRET analysis:

    • Create fluorescent protein pairs with tmem179 and candidate interactors

    • Measure energy transfer as evidence of close molecular proximity

    • Particularly useful for confirming direct interactions in living cells

  • Split-reporter assays:

    • Utilize split-GFP or NanoBiT complementation systems

    • Generate fusion constructs with tmem179 and potential partners

    • Monitor reporter activation as evidence of interaction

Based on findings from related proteins, potential interacting partners to investigate include components of the RIG-I-like receptor signaling pathway, MAVS, TBK1, and ER structural proteins . The N-terminal transmembrane domains (TM1 and TM2) should be specifically examined for their role in mediating these interactions.

How can researchers reconcile contradictory findings regarding tmem179 function across different model systems?

When facing contradictory results regarding tmem179 function, implement this systematic approach:

  • Model system differences assessment:

    • Compare protein sequence homology across species using multiple sequence alignment

    • Evaluate expression patterns in different tissues/developmental stages

    • Consider differences in signaling pathway components between models

  • Experimental methodology evaluation:

    • Scrutinize knockout/knockdown efficiency and specificity

    • Compare protein tagging strategies that might affect function

    • Analyze differences in experimental conditions (temperature, pH, ionic strength)

  • Resolution strategies:

    • Perform parallel experiments in multiple systems under identical conditions

    • Use complementary approaches (genetic knockdown, chemical inhibition)

    • Develop domain swap experiments to identify species-specific functional regions

  • Data integration framework:

    • Generate a comprehensive model that accounts for apparent contradictions

    • Consider context-dependent functions that might explain different observations

    • Use quantitative approaches to determine relative contributions of different pathways

When studying zebrafish tmem179, particular attention should be paid to developmental timing and tissue-specific effects, as zebrafish embryonic development involves distinct maternal and zygotic gene expression programs .

What are the critical considerations when developing antibodies against zebrafish tmem179?

Developing effective antibodies against zebrafish tmem179 requires careful planning:

  • Epitope selection strategy:

    • Target extracellular or cytoplasmic domains rather than transmembrane regions

    • Use species-specific sequences to avoid cross-reactivity

    • Select regions with high antigenicity and surface probability

    • Consider multiple epitopes to increase success probability

  • Immunization considerations:

    • Use synthetic peptides conjugated to carrier proteins

    • Consider recombinant protein fragments expressed in E. coli

    • Immunize species phylogenetically distant from zebrafish

  • Validation requirements:

    • Western blot against recombinant protein and zebrafish tissue extracts

    • Immunoprecipitation efficiency testing

    • Immunofluorescence to confirm expected subcellular localization

    • Comparison between wildtype and tmem179-depleted samples

  • Cross-reactivity testing:

    • Evaluate against related proteins (TMEM33, other TMEM family members)

    • Test in multiple zebrafish tissues to confirm specificity

Commercial antibodies, such as the affinity-purified goat polyclonal antibody raised against a tmem179 peptide epitope, can serve as reference standards . These antibodies are typically validated for research applications but should be independently verified for specific experimental conditions.

What analytical approaches are recommended for investigating the impact of tmem179 on cellular calcium homeostasis?

To investigate tmem179's potential role in calcium homeostasis, similar to TMEM33 , implement this methodological framework:

  • Real-time calcium imaging:

    • Utilize ratiometric indicators (Fura-2) or genetically encoded sensors (GCaMP)

    • Monitor baseline calcium levels in wildtype vs. tmem179-deficient cells

    • Measure calcium flux dynamics following store depletion (thapsigargin treatment)

    • Assess response to physiological stimuli that mobilize calcium

  • ER calcium store measurement:

    • Use specific ER-targeted calcium indicators

    • Quantify ER calcium content through controlled release experiments

    • Analyze refilling kinetics following store depletion

  • Electrophysiological approaches:

    • Patch-clamp analysis of calcium currents

    • Characterize store-operated calcium entry (SOCE)

    • Measure channel open probability in the presence/absence of tmem179

  • Protein-protein interaction analysis:

    • Investigate associations with known calcium handling proteins (STIM, Orai)

    • Examine co-localization with ER-plasma membrane contact sites

    • Assess phosphorylation status under calcium flux conditions

  • Data integration:

    • Develop mathematical models of calcium dynamics

    • Perform sensitivity analysis to quantify tmem179's contribution

    • Compare with effects of known calcium regulators

This comprehensive approach will help distinguish direct effects of tmem179 on calcium homeostasis from indirect consequences, providing insight into its fundamental cellular function.

How can zebrafish tmem179 research contribute to understanding human disease mechanisms?

Zebrafish tmem179 research offers valuable insights into human disease mechanisms through several translational pathways:

  • Comparative genomics approach:

    • The human TMEM179 gene maps to chromosome 14, which contains approximately 700 genes and is associated with several genetic disorders

    • Functional conservation between zebrafish and human proteins allows modeling of human disease variants

    • Specific domains critical for function in zebrafish can guide analysis of human mutations

  • Immune regulation insights:

    • Given the role of related proteins in antiviral immunity , tmem179 research may inform understanding of immunodeficiency disorders

    • Mechanisms of interferon regulation identified in zebrafish could reveal novel therapeutic targets for autoimmune conditions

    • Viral challenge models in zebrafish can recapitulate aspects of human viral susceptibility

  • Developmental disease modeling:

    • Zebrafish embryonic development provides a visible, accessible system to study genes with developmental roles

    • High-throughput screening capabilities allow testing of genetic and chemical modifiers

    • Cellular processes affected by tmem179 dysfunction can be linked to human pathologies

  • Therapeutic target validation:

    • Genetic rescue experiments in zebrafish can validate mechanism-based therapeutic approaches

    • Small molecule screens can identify compounds that modulate tmem179 function

    • Humanized zebrafish models expressing human TMEM179 variants can evaluate personalized interventions

The established role of chromosome 14 genes in human disorders like Alzheimer's disease (through presenilin 1) and α1-antitrypsin deficiency highlights the potential significance of all genes in this region, including TMEM179, in human health .

What methodological considerations are important when correlating zebrafish tmem179 findings with human TMEM179 function?

When translating findings from zebrafish tmem179 to human TMEM179, the following methodological approaches are essential:

  • Sequence and structure comparison:

    • Perform detailed alignment of protein sequences to identify conserved domains

    • Use homology modeling to predict structural similarities and differences

    • Identify post-translational modification sites that may differ between species

  • Expression pattern analysis:

    • Compare tissue-specific expression profiles between zebrafish and human tissues

    • Analyze temporal expression patterns during development

    • Identify cell types expressing TMEM179 in both species

  • Functional complementation studies:

    • Express human TMEM179 in zebrafish tmem179 mutants to assess functional rescue

    • Create chimeric proteins with domain swaps to identify species-specific regions

    • Use CRISPR/Cas9 to humanize zebrafish tmem179 sequences

  • Disease-relevant phenotyping:

    • Develop assays in zebrafish that reflect human pathological processes

    • Assess both molecular and physiological parameters with clinical relevance

    • Incorporate environmental factors that influence disease manifestation

  • Data validation in human systems:

    • Confirm key findings in human cell lines or patient-derived samples

    • Utilize tissue-specific differentiated cells from human iPSCs

    • Correlate zebrafish phenotypes with human clinical data when available

This systematic approach ensures that insights gained from the experimentally accessible zebrafish model can be meaningfully translated to human biology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.