Recombinant Danio rerio Transmembrane protein 17B (Tmem17b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem17b; zgc:163141; Transmembrane protein 17B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Tmem17b
Target Protein Sequence
MDLPEPIRRRLGDFSRTVFVDQSRTQPSFEEHANFLDQNKDVVSSLPLQMSLYFNMWFFP FWWISEVVMLDLKYSALADYYKFILITILIVMTLIEAIRLYLGNAGNLQEKVPELAGFWL LTFLLQFPLILFQLFNEAVLVQPLERGVHIILALFIFAEVLFGFVALRTMVRHTESRFHL RQFHGIQELRT
Uniprot No.

Target Background

Function
Transmembrane protein 17B (Tmem17b) is a transmembrane component of the tectonic-like complex. This complex is localized at the transition zone of primary cilia and functions as a barrier preventing diffusion of transmembrane proteins between the cilia and plasma membranes. Tmem17b is essential for ciliogenesis and sonic hedgehog (SHH) signaling.
Database Links
Protein Families
TMEM17 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

How is recombinant Tmem17b produced for research applications?

Recombinant Danio rerio Tmem17b is typically produced in E. coli expression systems using the following methodology:

  • The full-length gene encoding Tmem17b (amino acids 1-191) is cloned into an appropriate expression vector

  • An N-terminal His-tag is added to facilitate purification

  • The construct is transformed into E. coli cells

  • Protein expression is induced under controlled conditions

  • Cells are lysed and the protein is purified using affinity chromatography

  • Quality control is performed using SDS-PAGE to confirm purity (typically >90%)

  • The purified protein is lyophilized for stable storage and distribution

What are the optimal storage and reconstitution protocols for recombinant Tmem17b?

For optimal stability and experimental reliability, recombinant Tmem17b should be handled according to the following protocols:

Storage conditions:

  • Long-term storage: -20°C to -80°C

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

  • Supplied as lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Create multiple small aliquots to minimize future freeze-thaw cycles

  • For long-term storage, keep aliquots at -20°C/-80°C

What signaling pathways might Tmem17b be involved in based on homologous proteins?

While specific signaling pathways for Danio rerio Tmem17b have not been fully characterized, insights from related proteins suggest several possible mechanisms:

Human TMEM17 has been shown to be involved in the AKT/GSK3β/β-catenin/Snail signaling pathway, particularly in breast cancer cells. Experimental investigations in zebrafish models should consider:

  • Potential involvement in AKT-mediated pathways:

    • TMEM17 upregulates p-AKT (Ser 473) in human cells

    • This activation can be blocked by AKT inhibitors like LY294002

  • Downstream effects on GSK3β/β-catenin signaling:

    • TMEM17 increases GSK3β phosphorylation at Ser 9

    • Results in increased active β-catenin levels

    • Leads to upregulation of c-myc and cyclin D1 expression

  • Potential role in epithelial-mesenchymal transition (EMT):

    • Regulates Snail expression

    • Downregulates E-cadherin levels

    • May influence cell migration and invasiveness

Methodologically, researchers should employ Western blotting to assess phosphorylation status, reporter assays to measure transcriptional activity, and inhibitor studies to validate pathway components.

What experimental models are most effective for studying Tmem17b function?

Several experimental models can be employed to study Tmem17b function, each with specific advantages:

1. Zebrafish embryo models:

  • Optical transparency allows real-time visualization

  • Amenable to genetic manipulation via morpholinos or CRISPR-Cas9

  • Enables assessment of developmental phenotypes

  • Facilitates high-throughput screening

2. Cell-based systems:

  • Zebrafish cell lines (ZF4, PAC2) for in vitro studies

  • Heterologous expression in mammalian cells

  • Useful for protein localization and trafficking studies

3. Advanced genetic models:

  • Transgenic zebrafish expressing fluorescently tagged Tmem17b

  • Inducible knockout/knockin systems

  • Tissue-specific promoters for targeted expression

4. Integrated approaches:

ApproachMethodologyKey Applications
Loss-of-functionMorpholinos, CRISPR-Cas9Developmental roles, phenotypic assessment
Gain-of-functionmRNA injection, transgenic overexpressionRescue experiments, pathway analysis
Live imagingFluorescent tagging, time-lapse microscopyProtein localization, dynamics
Biochemical analysisCo-IP, proximity labelingProtein interactions, complex formation
TranscriptomicsRNA-seq following manipulationDownstream gene regulation

The selection of appropriate models should be guided by the specific research question, with consideration given to temporal and spatial regulation of Tmem17b expression .

How can Tmem17b be incorporated into comprehensive proteomics studies?

Tmem17b can be effectively studied using modern proteomics approaches adapted for membrane proteins:

1. Sample preparation strategies:

  • Membrane fractionation to enrich for transmembrane proteins

  • Detergent-based solubilization optimized for hydrophobic proteins

  • Immunoprecipitation to capture Tmem17b and interacting partners

2. Advanced proteomics workflow:

  • S-trap (Suspension Trapping) methodology for efficient membrane protein digestion

  • iTRAQ (Isobaric Tags for Relative and Absolute Quantitation) labeling for quantitative comparisons

  • 2D LC-MS/MS analysis for comprehensive proteome coverage

  • Targeted approaches for focused analysis of Tmem17b and interactors

3. Bioinformatic analysis:

  • Functional assessment through KEGG pathway analysis

  • KOG (Eukaryotic Orthologous Group) classification

  • GO (Gene Ontology) term enrichment

  • Protein-protein interaction network mapping

4. Methodological considerations for Tmem17b:

  • Special attention to hydrophobic peptides during LC-MS/MS

  • Appropriate controls for antibody specificity in immunoprecipitation

  • Validation of identified interactions through orthogonal methods

  • Integration with transcriptomic data for comprehensive understanding

What techniques are most effective for detecting Tmem17b expression in zebrafish tissues?

Multiple complementary techniques can be employed to detect and quantify Tmem17b expression:

1. Nucleic acid-based detection:

  • RT-PCR and qRT-PCR with Tmem17b-specific primers

  • In situ hybridization (whole-mount or sectioned) using antisense RNA probes

  • RNAscope for single-molecule detection with higher specificity

  • RNA-seq for transcriptome-wide expression analysis

2. Protein-based detection:

  • Western blotting with optimized extraction protocols for membrane proteins

    • Expected molecular weight: approximately 21-22 kDa

    • Positive control: recombinant Tmem17b protein

  • Immunohistochemistry/immunofluorescence

    • Fixation: 4% paraformaldehyde recommended

    • May require membrane permeabilization for optimal antibody access

  • Flow cytometry for quantitative analysis in cell suspensions

3. Reporter systems:

  • BAC recombineering to maintain endogenous regulatory elements

  • CRISPR knock-in of fluorescent tags

  • Promoter-reporter constructs for analysis of expression regulation

4. Method selection criteria:

MethodSensitivitySpatial ResolutionQuantificationLive AnalysisTechnical Complexity
qRT-PCRHighNoneExcellentNoLow
In situ hybridizationMediumHighLimitedNoMedium
Western blotMediumNoneGoodNoLow
ImmunofluorescenceMediumHighLimitedNoMedium
Transgenic reportersMediumHighLimitedYesHigh

The choice of technique should be guided by specific research questions and available resources .

How does Tmem17b knockdown affect zebrafish development and physiology?

Investigating the phenotypic consequences of Tmem17b knockdown requires systematic analysis:

1. Genetic manipulation approaches:

  • Morpholino oligonucleotides

    • Translation-blocking (targeting start codon)

    • Splice-blocking (targeting exon-intron boundaries)

    • Dosage titration to minimize off-target effects

  • CRISPR-Cas9 genome editing

    • gRNA design targeting early exons

    • Establishment of stable mutant lines

2. Phenotypic analysis framework:

  • Morphological assessment

    • Gross morphology at key developmental stages

    • Organ formation and patterning

    • Quantitative measurements (body length, head size)

  • Cellular analysis

    • Proliferation (phospho-histone H3 staining)

    • Apoptosis (TUNEL assay)

  • Molecular consequences

    • Transcriptome changes via RNA-seq

    • Proteome alterations

    • Effects on signaling pathways (especially AKT/GSK3β/β-catenin)

3. Functional validation:

  • Rescue experiments with co-injection of Tmem17b mRNA

  • Targeted chemical interventions in affected pathways

  • Cross-species comparison with mammalian TMEM17 models

Based on studies of related TMEM proteins, potential phenotypes might include alterations in cell migration, epithelial organization, or immune system development. The presence of TMEM17 in cancer progression pathways suggests potential roles in cell proliferation and tissue homeostasis .

How does Tmem17b relate functionally to other TMEM family proteins?

The TMEM (transmembrane) protein family comprises numerous members with diverse functions. Tmem17b's relationship to other family members provides context for functional prediction:

1. Structural relationships within the TMEM family:

  • Classification based on membrane topology and domain organization

  • Shared structural features with TMEM17 across species

  • Distinct from but potentially functionally related to TMEM176B

2. Functional connections:

  • TMEM17 in humans promotes cancer progression via AKT/GSK3β/β-catenin/Snail signaling

  • TMEM176B influences antitumor immunity and immune cell function

  • Other TMEM proteins are involved in ciliary function, membrane trafficking, and ion transport

3. Experimental approaches to establish functional relationships:

  • Co-expression analysis across developmental stages and tissues

  • Protein-protein interaction studies to identify shared partners

  • Functional genomics with combined knockdowns to identify redundancy

4. Comparative signaling pathway involvement:

  • TMEM17 upregulates p-AKT, p-GSK3β, active β-catenin, and Snail in breast cancer cells

  • These effects can be reversed by AKT inhibitor LY294002

  • Downstream effects include increased cancer cell proliferation, invasion, and migration

Understanding these relationships can guide hypothesis generation about Tmem17b function in zebrafish development and disease models.

What methods are most effective for studying Tmem17b protein-protein interactions?

Investigating Tmem17b's protein interaction network requires specialized approaches for membrane proteins:

1. Affinity-based methods:

  • Co-immunoprecipitation with Tmem17b-specific antibodies

    • Requires careful optimization of detergent conditions

    • Controls for antibody specificity are essential

  • Pull-down assays using tagged recombinant Tmem17b

    • His-tagged protein can serve as bait for potential interactors

    • Can be performed with cell lysates or tissue extracts

2. Proximity-based approaches:

  • BioID or TurboID fusion proteins

    • Fusion of biotin ligase to Tmem17b

    • Enables biotinylation of proximal proteins

    • Particularly valuable for transient interactions

  • APEX2 proximity labeling

    • Provides spatial resolution of interactions

    • Compatible with electron microscopy visualization

3. Genetic screening methods:

  • Yeast two-hybrid with membrane protein adaptations

    • Split-ubiquitin yeast two-hybrid for membrane proteins

    • MYTH (Membrane Yeast Two-Hybrid) system

  • Genetic interaction screens in zebrafish

    • Synthetic phenotypes with other gene knockdowns

    • Enhancer/suppressor screens

4. Advanced proteomic approaches:

  • Crosslinking mass spectrometry (XL-MS)

    • Captures direct protein-protein interactions

    • Provides structural constraints for interaction models

  • Blue native PAGE for membrane protein complexes

    • Preserves native protein complexes

    • Can be coupled with mass spectrometry for identification

5. Computational prediction and validation:

  • Structural modeling of Tmem17b

  • Interface prediction algorithms

  • Integration with experimental data for refinement

How can researchers effectively measure the impact of Tmem17b on signaling pathways?

To evaluate Tmem17b's influence on cellular signaling networks, researchers should implement a multi-faceted approach:

1. Phosphorylation-based signaling analysis:

  • Western blotting for key phosphorylated proteins

    • Focus on AKT (pSer473), GSK3β (pSer9)

    • Analysis of β-catenin activation status

    • Examination of downstream targets (c-myc, cyclin D1)

  • Phosphoproteomic profiling

    • Global analysis of phosphorylation changes

    • Temporal dynamics following Tmem17b manipulation

2. Transcriptional readouts:

  • Reporter assays for pathway-specific transcription factors

    • TCF/LEF reporters for Wnt/β-catenin signaling

    • FOXO reporters for AKT pathway activity

  • RNA-seq analysis following Tmem17b modulation

    • Identification of differentially expressed genes

    • Pathway enrichment analysis

3. Functional validation:

  • Pharmacological inhibitors/activators

    • AKT inhibitors (LY294002) to block potential Tmem17b-mediated effects

    • GSK3β inhibitors to mimic pathway activation

  • Genetic approaches

    • Combined knockdown with pathway components

    • Epistasis analysis to determine pathway hierarchy

4. Visualization techniques:

  • Fluorescent biosensors

    • FRET-based reporters for kinase activity

    • Translocation-based reporters for protein localization

  • Immunofluorescence for protein localization changes

    • β-catenin nuclear translocation

    • E-cadherin membrane localization

Based on studies of human TMEM17, researchers should particularly focus on AKT/GSK3β/β-catenin/Snail signaling, as TMEM17 has been shown to upregulate p-AKT and promote downstream pathway activation in human cancer cells .

What are the challenges and solutions in purifying functional recombinant Tmem17b?

Purification of functional transmembrane proteins presents unique challenges that require specialized approaches:

1. Expression system optimization:

SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, low costLimited post-translational modificationsUse for structural studies, antibody production
Insect cellsBetter folding, some modificationsMore complex, lower yieldConsider for functional studies
Mammalian cellsNative-like modificationsHighest complexity, lowest yieldBest for interaction studies

2. Solubilization strategies:

  • Detergent selection is critical

    • Non-ionic detergents (DDM, LMNG) preserve protein structure

    • Detergent concentration optimization is essential

  • Amphipol or nanodisc reconstitution for stability

    • Maintains native-like membrane environment

    • Improves protein stability for functional studies

3. Purification challenges and solutions:

  • Affinity chromatography optimization

    • His-tag position (N- vs C-terminal) affects accessibility

    • Two-step purification improves purity

  • Quality control measures

    • SEC (size exclusion chromatography) for aggregation assessment

    • Thermal stability assays to confirm proper folding

4. Functional validation methods:

  • Circular dichroism to assess secondary structure

  • Binding assays for known interactors

  • Reconstitution into liposomes for functional studies

Current protocols typically use E. coli expression with His-tag purification, resulting in lyophilized protein that requires careful reconstitution. For studies requiring fully functional protein, mammalian expression systems may offer advantages despite lower yields .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.