Recombinant Danio rerio Transmembrane protein 192 (tmem192)

Shipped with Ice Packs
In Stock

Description

Autophagy and Apoptosis Regulation

  • In vitro knockdown: TMEM192 deficiency in HepG2 hepatoma cells triggers autophagy (LC3-II accumulation) and apoptosis via Bax upregulation, caspase-3 activation, and p38 MAPK phosphorylation .

  • In vivo compensation: Murine TMEM192 knockout models show no detectable lysosomal dysfunction or autophagy impairment under basal conditions, suggesting redundant pathways .

Lysophagy and Ubiquitination

  • TMEM192 is ubiquitinated at lysine residues (K201, K211, K237, K246, K254) on its cytosolic C-terminus during lysosomal damage, facilitating lysophagy (selective lysosome degradation) .

  • Structural predictions highlight an alpha-helical domain (residues 228–265) critical for protein interactions .

Research Applications

  • Lysosome isolation: TMEM192’s strong lysosomal localization makes it ideal for organelle purification .

  • Disease modeling: Used to study lysosomal storage disorders, neurodegenerative diseases, and cancer mechanisms in zebrafish .

  • Protein interaction studies: Partners with STK11IP via its C-terminus, implicating roles in lysosomal signaling .

Comparative Biochemical Properties

FeatureZebrafish TMEM192Human TMEM192
Disulfide bondsNot observed (murine data) Cysteine-dependent dimerization
Tissue expressionUbiquitous (ZFIN data) High in liver, brain
Proteolytic processingUndocumentedGenerates 17 kDa NTF

Future Directions

  • Functional redundancy: Further studies needed to elucidate compensatory mechanisms in TMEM192-deficient zebrafish.

  • Structural resolution: Cryo-EM or crystallography could clarify dimerization and interaction interfaces.

  • Therapeutic targeting: Explore TMEM192’s role in lysosomal disease pathways for drug development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tmem192; zgc:77068; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem192
Target Protein Sequence
MVMESGRTSAYGNNTNVDFTQSTDDDPLIDGPLVSQDALESAIKREFQTLSTHWAVGVLS FLHVVYVVVCIVITVFCWISDEHTSECTAALNGIDSKTVVLLGKVALWVVVFIYDRVVQR RHSAVRRKGYLDFYRMTKGIKSLPLLIHSAGNAAILTVIAPSSLLDANVKNLSVYLLLAI ICLELLLTIICLLRYTVHVVKFNRKKPHPDVTEEERSYGCSSDAHTETGFRDGSSLEDVV EKQADLIDYLKQHNSVLSRRILTLTGQQIRA
Uniprot No.

Target Background

Database Links
Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.

Q&A

What is TMEM192 and what is its biological function in Danio rerio?

TMEM192 (Transmembrane Protein 192) is a cell surface protein expressed in zebrafish with a structural topology that includes transmembrane domains. In zebrafish (Danio rerio), TMEM192 plays a crucial role in lysosomal biology, particularly in mechanisms related to lysosomal membrane integrity and function. Recent research has utilized TMEM192 as a basis for developing specific probes to investigate lysophagy, which is a specialized form of selective autophagy targeting damaged lysosomes for degradation . The protein's location on lysosomal membranes makes it an excellent marker for studying lysosomal dynamics and damage response pathways in cellular models.

What are the key structural and genetic characteristics of zebrafish TMEM192?

Recombinant Zebrafish TMEM192 is encoded by the gene with ID 797335, with its mRNA sequence referenced as NM_001102393 and protein sequence as NP_001095863 in the NCBI database. The protein is cataloged in UniProt under the ID Q6NYE7 . While the exact 3D structure remains to be fully characterized, recombinant forms of the protein are typically produced with His-tags to facilitate purification and detection in experimental settings. The protein can be expressed in mammalian cell systems to maintain appropriate post-translational modifications relevant to its function .

How does zebrafish TMEM192 compare with homologous proteins in other species?

Zebrafish TMEM192 shares conserved domains and functional homology with TMEM192 proteins found in other vertebrates, including humans and rodents. Similar to other transmembrane proteins studied in zebrafish models (such as TMEM2 and TMEM216), TMEM192 likely maintains evolutionarily conserved functions across species . This conservation makes zebrafish an excellent model organism for studying TMEM192-related pathways that may be relevant to human biology and disease. The zebrafish model offers advantages for developmental and genetic studies while maintaining sufficient protein similarity to draw meaningful comparisons with mammalian systems.

How can TMEM192-based probes be utilized to study lysophagy mechanisms?

TMEM192-based probes, particularly the TMEM192-mKeima system, have been developed as specialized tools to study lysophagy with higher specificity than conventional approaches. The TMEM192-mKeima probe facilitates direct assessment of lysophagy processes by enabling researchers to track the fate of lysosomes and distinguish between different lysosomal damage response pathways . This probe system works by fusing the pH-sensitive fluorescent protein mKeima to TMEM192, allowing real-time visualization of lysosomal pH changes and tracking of damaged lysosomes as they undergo autophagic degradation. Through comparative analysis with galectin-3 assays (which detect damaged lysosomes but are less specific to lysophagy), researchers have demonstrated that TMEM192-mKeima provides more targeted insights into the selective autophagy of damaged lysosomes .

What factors influence the initial steps of lysophagy as revealed through TMEM192-based studies?

Research utilizing TMEM192-mKeima probes has identified several key molecular players involved in the initial steps of lysophagy. Studies have revealed that ubiquitin-conjugating enzymes UBE2L3 and UBE2N, along with TRIM family proteins (specifically TRIM10, TRIM16, and TRIM27), play significant roles in the early stages of lysophagy . Interestingly, while previously thought to be central to lysophagy, transcription factor EB (TFEB) and the autophagy receptor p62 appear to contribute to broader lysosomal damage responses rather than specifically to lysophagy mechanisms. These findings demonstrate how TMEM192-based tools have enabled more precise delineation of the molecular pathways involved in lysosomal quality control .

How does oxidative stress modulate TMEM192 function in zebrafish models?

While direct evidence on TMEM192's response to oxidative stress is limited in the provided search results, zebrafish models have established frameworks for studying redox signaling and stress responses that likely apply to TMEM192 research. The Nrf2 pathway, a key regulator of oxidative stress responses in vertebrates including zebrafish, may influence TMEM192 function under oxidative conditions . Given that lysosomal damage often occurs during oxidative stress, and TMEM192 is involved in lysosomal homeostasis, investigating the intersection of Nrf2 signaling with TMEM192-mediated processes could reveal important regulatory mechanisms. Further research using TMEM192-mKeima probes under oxidative challenge conditions would help elucidate these relationships.

What expression systems are optimal for producing recombinant Danio rerio TMEM192?

For recombinant production of zebrafish TMEM192, mammalian cell expression systems are frequently employed to ensure proper protein folding and post-translational modifications . While bacterial expression systems (such as E. coli) are sometimes used for other transmembrane proteins from zebrafish, the more complex topology of TMEM192 makes mammalian systems preferable for maintaining functional integrity. The recombinant protein is typically tagged with histidine (His-tag) to facilitate purification using affinity chromatography techniques . Researchers should consider that the expression system choice significantly impacts protein quality, and functional studies may require proteins expressed in systems that closely approximate the native context.

What are the optimal storage and handling conditions for recombinant TMEM192 preparations?

Recombinant zebrafish TMEM192 is typically available in either liquid formulation or as a lyophilized powder. For short-term storage, the protein should be maintained at +4°C, while long-term storage requires temperatures between -20°C and -80°C . When working with lyophilized forms, reconstitution should be performed carefully to maintain protein integrity. For related transmembrane proteins, reconstitution in deionized sterile water to concentrations of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for aliquots intended for long-term storage . Repeated freeze-thaw cycles should be avoided to prevent protein degradation and activity loss.

What quality control parameters should be assessed when working with recombinant TMEM192?

Critical quality control parameters for recombinant zebrafish TMEM192 include purity (typically >80% as determined by SDS-PAGE), endotoxin levels (<1.0 EU per μg of protein), and functional activity verification . Researchers should confirm proper protein folding and integrity through techniques such as circular dichroism or limited proteolysis. For transmembrane proteins, verifying correct membrane topology is essential, particularly when the protein will be used in functional studies. Additionally, lot-to-lot consistency should be evaluated when conducting longitudinal studies to ensure experimental reproducibility.

How can TMEM192-mKeima probes be implemented to study lysosomal damage in zebrafish models?

Implementation of TMEM192-mKeima probes in zebrafish models offers unique advantages for studying lysosomal biology in vivo. The dual-excitation properties of mKeima allow researchers to distinguish between intact lysosomes (acidic environment) and damaged lysosomes undergoing autophagic degradation (neutral pH environment) . To implement this system in zebrafish models, researchers typically generate transgenic lines expressing the TMEM192-mKeima construct under tissue-specific promoters. This approach enables real-time monitoring of lysophagy in specific tissues during development or under various stress conditions. The optical transparency of zebrafish embryos makes them particularly well-suited for imaging-based studies using this fluorescent probe system.

What comparative insights have been gained from studying TMEM192 across different species?

Comparative studies of TMEM192 across species have revealed evolutionarily conserved mechanisms in lysosomal biology. While the search results don't provide direct cross-species comparisons for TMEM192, other transmembrane proteins like TMEM2 demonstrate how zebrafish models can provide valuable insights applicable to mammalian systems . Research on related transmembrane proteins suggests that zebrafish TMEM192 likely maintains core functional domains found in mammalian orthologs, while potentially exhibiting species-specific regulatory mechanisms. These comparative approaches help identify fundamental principles of lysosomal biology that have been preserved through evolution and distinguish them from species-specific adaptations.

What are the key challenges in developing assays specific to lysophagy versus general lysosomal damage?

A significant challenge in studying lysosomal biology has been distinguishing specific lysophagy processes from broader lysosomal damage responses. Conventional methods like galectin-3 assays detect general lysosomal membrane damage but lack specificity for the autophagic clearance of damaged lysosomes . The development of TMEM192-mKeima probes has addressed this challenge by providing a more targeted approach for monitoring lysophagy specifically. This technical advancement has enabled researchers to differentiate between multiple response pathways following lysosomal damage and correctly attribute molecular players to their specific roles. For example, using TMEM192-mKeima, researchers determined that TFEB and p62, previously considered central to lysophagy, actually contribute to broader lysosomal damage responses rather than specifically to lysophagy .

How can researchers address potential interference from endogenous proteins when using recombinant TMEM192 in experimental systems?

When introducing recombinant TMEM192 or TMEM192-based probes into experimental systems, potential interference from endogenous TMEM192 or related proteins must be considered. One approach to address this challenge is using CRISPR/Cas9 genome editing to create knockout models lacking endogenous TMEM192 before introducing the recombinant or modified protein. Alternatively, researchers can employ specific experimental designs that allow differentiation between endogenous and recombinant proteins, such as using distinctive tags or species-specific antibodies. For functional studies, careful titration of recombinant protein concentrations is essential to avoid overwhelming endogenous systems while ensuring sufficient levels for detection and analysis.

Experimental ApproachAdvantagesLimitationsBest Applications
TMEM192-mKeima probeHigh specificity for lysophagy; Dual-excitation properties allow pH monitoringRequires genetic modification of cells/organismsMechanistic studies of selective autophagy pathways
Galectin-3 assayDetects general lysosomal damage; Compatible with fixed samplesLower specificity for lysophagyInitial screening for lysosomal membrane damage
Recombinant TMEM192 supplementationAllows controlled dosing in experimental systemsPotential interference with endogenous proteinsStructure-function relationship studies
TMEM192 knockout/knockdownReveals protein's physiological significanceMay have developmental consequencesLoss-of-function studies

How might TMEM192 research intersect with studies on Nrf2-mediated stress responses in zebrafish models?

Future research could productively explore the potential intersection between TMEM192 function and Nrf2-mediated stress response pathways in zebrafish. Given that Nrf2 is a key regulator of genes involved in protection against oxidative stress in vertebrates including zebrafish , and lysosomal damage often occurs under oxidative conditions, investigating potential regulatory relationships between these systems could reveal important mechanistic insights. Hypotheses to explore include whether TMEM192 expression or function is regulated by Nrf2 activation, whether TMEM192-dependent lysophagy contributes to cellular resilience during oxidative challenges, and whether there are direct molecular interactions between components of these pathways.

What potential roles might zebrafish TMEM192 play in developmental processes and disease models?

Investigation of TMEM192's developmental roles in zebrafish represents an important future direction. The established use of zebrafish in developmental biology and toxicology studies provides an excellent platform for examining TMEM192 functions during embryonic and larval development. Research questions could address whether TMEM192 expression shows temporal or tissue-specific patterns during development, whether it contributes to organogenesis or tissue remodeling, and whether mutations in TMEM192 result in developmental abnormalities. Additionally, given the connection between lysosomal dysfunction and various human diseases, zebrafish TMEM192 models could provide valuable insights into pathological mechanisms and potential therapeutic approaches for lysosomal storage disorders, neurodegenerative conditions, and other diseases involving impaired cellular quality control systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.