Recombinant Danio rerio Transmembrane protein 208 (tmem208)

Shipped with Ice Packs
In Stock

Description

General Information

TMEM208 is an ER-located protein prone to forming SDS-resistant aggregates upon heat treatment . Overexpression of TMEM208 negatively regulates autophagy and ER stress, while gene knockdown enhances autophagy and triggers ER stress . Database searches using National Center for Biotechnology Information (NCBI) and European Bioinformatics Institute (EBI) revealed that the TMEM208 sequence is highly conserved across many species . Evolution analysis also indicated that TMEM208 is evolutionarily highly conserved . A highly conserved protein domain named DUF788, whose function remains unknown, spans almost the whole sequence of TMEM208 .

Structure

TMEM208 has three transmembrane (TM) domains, two of which are predicted to be at the N-terminal . The two adjacent N-terminal TM domains are the reason for aggregate formation upon heat treatment, while the C-terminal (70–173), which contains one TM domain, failed to form aggregates .

Function

TMEM208 regulates both ER stress and autophagy . When overexpressed, TMEM208 impairs autophagy, characterized by the decrease of LC3-II accumulation, decreased degradation of autophagic substrates, and reduced expression of critical effectors and vital molecules of the ER stress and autophagy processes . Conversely, knockdown of the TMEM208 gene promotes autophagy, as demonstrated by the increase of LC3-II, increased degradation of autophagic substrates, and enhanced expression levels for genes key in the ER stress and autophagic processes .

TMEM208 and ER Stress

Given TMEM208's location in the ER, it can impact ER stress . Overexpression of TMEM208 in U2OS cells resulted in the downregulation of mRNA levels for ER-stress marker molecules, including ATF6, ATF4, and CHOP . Downregulation of mRNA levels of key autophagy molecules, including LC3, ATG5, and ATG12, were also evident in TMEM208 overexpressing cells . In contrast, the knockdown of TMEM208 resulted in the upregulation of mRNA levels of GRP78, ATF6, ATF4, LC3, ATG5, CHOP, and ATG12 . The levels of the ER-resident chaperone GRP78 mRNA, which is a classical marker and regulator of the ER stress response, were significantly increased in both TMEM208 overexpressing and TMEM208 knockdown cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem208; zgc:77041; Transmembrane protein 208
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem208
Target Protein Sequence
MAPKGKVGTKGKKQIHEENQDTLKFYSRIILGANAIYIAVNLLLFYNSSSFWTWFSLMFA VAVYVGSYRSMSAMAKPAFAEDGSLLDGGIDLNMEQGMAEHLKDVILLTAIVQVLSTLSS YFWYLWLLAPARALHLLWVNFLGPWFSADSQAAPEENEKNDKKQRRQERRQMRRF
Uniprot No.

Target Background

Function
May function as a negative regulator of endoplasmic reticulum-stress-induced autophagy.
Database Links
Protein Families
TMEM208 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is tmem208 and what is its biological significance?

Transmembrane protein 208 (tmem208) belongs to a large family of proteins that span the entire width of the lipid bilayer surrounding cells and organelles in multicellular organisms. These proteins are abundant in most cells and functionally important, though the specific biological roles of many individual TMEM proteins, including tmem208, have remained largely uncharacterized until recently .

Research from Dr. Hugo J. Bellen's laboratory at Baylor College of Medicine has revealed that tmem208 plays a critical role in development. Studies published in the Proceedings of the National Academy of Sciences demonstrated that organisms lacking this gene either do not survive or develop significant developmental abnormalities, suggesting its involvement in fundamental developmental pathways .

To properly investigate tmem208 function, researchers must consider:

  • Its subcellular localization (primarily in the endoplasmic reticulum)

  • Its evolutionary conservation across species

  • Its involvement in protein processing and trafficking

  • Its potential role in maintaining cellular homeostasis

How conserved is tmem208 across species, and what does this tell us about its function?

The tmem208 gene demonstrates significant evolutionary conservation, suggesting it serves an essential biological function. Comparative studies between human TMEM208 and zebrafish tmem208 reveal structural and functional homology . This conservation extends to other model organisms as well.

Evidence for conservation comes from studies showing that:

  • Loss of Tmem208 in fruit flies results in developmental defects similar to those observed in humans with TMEM208 variants

  • The protein's subcellular localization in the endoplasmic reticulum is consistent across species

  • The molecular structure and transmembrane domains show high sequence similarity

This cross-species conservation makes zebrafish an excellent model organism for studying tmem208 function, as findings may be translatable to human health and disease contexts .

What cellular processes involve tmem208 based on current research?

Current research indicates that tmem208 is involved in several critical cellular processes:

  • Endoplasmic reticulum function: Many TMEM proteins, including tmem208, localize to the endoplasmic reticulum, where they participate in protein folding, quality control, processing, sorting, and trafficking .

  • Developmental regulation: The severe phenotypes observed in tmem208-deficient organisms suggest its importance in developmental pathways. The specific mechanisms may involve:

    • Cell polarity establishment

    • Protein trafficking necessary for developmental signaling

    • Endoplasmic reticulum stress responses

  • Potential immune functions: While direct evidence linking tmem208 to immune function is limited, the zebrafish model has revealed that various transmembrane proteins play roles in innate immunity, potentially suggesting another avenue for tmem208 function .

Further research is needed to fully characterize the molecular pathways and interaction partners of tmem208 in zebrafish and other organisms.

What are the optimal methods for expressing recombinant tmem208 in zebrafish?

Based on established protocols for recombinant protein expression in zebrafish, researchers can employ several approaches to express tmem208:

mRNA Injection Method:

  • Generate a pCS2+ vector containing the tmem208 sequence optimized with a zebrafish consensus Kozak sequence (GCAAACatgGCG)

  • Add appropriate tags (such as FLAG or GFP) with flexible linkers

  • Linearize the plasmid and perform in vitro transcription

  • Inject the synthesized mRNA into zebrafish embryos at the one-cell stage

  • Validate expression through Western blot analysis using tag-specific antibodies

Transgenic Expression System:

  • Clone the tmem208 sequence into a Gateway-compatible Tol2kit vector

  • Use a heat shock promoter (HSP70l) for inducible expression

  • Include a tissue-specific marker (e.g., cardiomyocyte-specific GFP) for identifying integration-positive embryos

  • Co-inject the construct with Tol2 transposase mRNA for genomic integration

  • Establish stable transgenic lines through founder screening

The transgenic approach offers advantages for long-term studies and tissue-specific expression, while the mRNA injection method provides faster results for preliminary investigations.

How can researchers effectively design knockdown or knockout models of tmem208 in zebrafish?

To investigate tmem208 function through loss-of-function approaches, researchers can utilize several complementary techniques:

CRISPR/Cas9 Knockout Strategy:

  • Design guide RNAs targeting conserved regions of zebrafish tmem208

  • Inject Cas9 protein and guide RNAs into one-cell stage embryos

  • Screen for mutations using T7 endonuclease assays or high-resolution melting analysis

  • Confirm mutations through sequencing

  • Establish stable mutant lines through founder screening and outcrossing

Morpholino-Based Knockdown:

  • Design antisense morpholinos targeting either the translation start site or splice junctions of tmem208

  • Validate morpholino specificity through rescue experiments with morpholino-resistant mRNA

  • Inject optimized concentrations into one-cell stage embryos

  • Include appropriate controls (standard control morpholino, rescue constructs)

  • Assess knockdown efficiency through RT-PCR (for splice-blocking morpholinos) or Western blot analysis

Considerations for Phenotypic Analysis:

  • Examine developmental milestones and morphology

  • Investigate cellular defects through immunohistochemistry

  • Perform transcriptomic analysis to identify affected pathways

  • Consider tissue-specific conditional approaches if global knockout is lethal

What proximity labeling techniques are most effective for identifying tmem208 interaction partners in zebrafish?

Proximity-dependent biotinylation offers powerful approaches for identifying protein interaction networks in vivo. For tmem208, researchers can implement:

TurboID or miniTurbo System:

  • Generate fusion constructs with zebrafish-optimized TurboID or miniTurbo linked to tmem208

  • Express the fusion protein through either mRNA injection or transgenic approaches

  • Provide biotin directly in the egg water (12 hours of labeling is sufficient)

  • Harvest embryos and perform streptavidin pulldown of biotinylated proteins

  • Identify interaction partners through mass spectrometry analysis

Comparative Approach:

FeatureTurboIDminiTurboBioID
Labeling Time12h12h24h+
Size35 kDa28 kDa35 kDa
Activity in ZebrafishHighHighModerate
BackgroundModerateLowerLow
Best ApplicationDevelopmental studiesTemporal studiesStable complexes

Validation Strategies:

  • Use GFP-fusion controls to identify non-specific biotinylation

  • Perform statistical scoring of identified proteins

  • Validate key interactions through co-immunoprecipitation or co-localization studies

  • Employ transgenic lines with heat shock-inducible expression for temporal control

This approach has successfully identified nuclear envelope and nuclear membrane proteins in zebrafish when applied to lamin A, indicating its potential effectiveness for studying transmembrane proteins like tmem208 .

How does tmem208 dysfunction contribute to developmental disorders?

Research suggests tmem208 dysfunction may contribute to developmental disorders through several mechanisms:

  • Disruption of ER function: As tmem208 localizes to the endoplasmic reticulum, its dysfunction may impair protein folding, quality control, and trafficking, leading to ER stress and cellular dysfunction .

  • Cell polarity defects: Studies in fruit flies demonstrate that Tmem208 mutants show cell polarity defects, which could disrupt tissue organization during development .

  • Clinical evidence: A human case study reported that a child with variants in both copies of TMEM208 presented with global developmental delays, seizures, and a multisystem disorder. The overlapping symptoms between this patient and animal models suggest tmem208 deficiency affects fundamental developmental pathways .

  • Potential mechanisms:

    • Disruption of protein trafficking required for developmental signaling

    • Chronic ER stress triggering cell death in developing tissues

    • Altered membrane dynamics affecting cell-cell communication

Research using zebrafish models can help elucidate the precise developmental pathways affected by tmem208 dysfunction, potentially leading to therapeutic strategies for related human disorders.

What are the challenges in analyzing tmem208 function across different tissues in zebrafish?

Investigating tmem208 function across diverse tissues presents several technical and biological challenges:

Technical Challenges:

  • Tissue-specific expression analysis: Determining the endogenous expression pattern of tmem208 across different tissues and developmental stages requires sensitive detection methods such as in situ hybridization or transgenic reporter lines.

  • Conditional manipulation: If global knockout is lethal, tissue-specific or temporally controlled approaches become necessary, requiring optimization of Cre-lox or similar systems in zebrafish.

  • Protein detection: The detection of endogenous tmem208 protein may be hampered by low expression levels or antibody specificity issues, necessitating epitope tagging approaches.

Biological Considerations:

  • Functional redundancy: Zebrafish underwent a genome duplication, potentially resulting in redundant genes compensating for tmem208 loss in specific tissues.

  • Tissue-specific interaction partners: tmem208 may interact with different proteins in different tissues, requiring tissue-specific proximity labeling approaches.

  • Developmental timing: The importance of tmem208 may vary throughout development, necessitating stage-specific analyses.

Recommended Approaches:

  • Generate tissue-specific transgenic lines using the Tol2 system with tissue-specific promoters

  • Employ heat-shock inducible systems for temporal control of expression or knockout

  • Consider single-cell approaches to overcome tissue heterogeneity

  • Utilize tissue-specific CRISPR approaches for conditional knockout

How can researchers integrate tmem208 studies with innate immunity research in zebrafish?

Zebrafish serve as excellent models for studying innate immunity, and the potential connection to tmem208 can be explored through several approaches:

  • Infection challenge models: Expose tmem208-deficient zebrafish to common pathogens to assess immune response alterations:

    • Bacterial pathogens (e.g., Pseudomonas aeruginosa)

    • Viral challenges

    • Fungal infections (e.g., Candida albicans)

  • Inflammatory pathway analysis: Investigate whether tmem208 affects key immune signaling pathways:

    • NF-κB pathway activation using NF-κB transgenic reporter zebrafish

    • Expression of pro-inflammatory cytokines (IL-1β, IL-6, TNFα)

    • Neutrophil and macrophage recruitment and function

  • Pattern recognition receptor interactions: Examine potential interactions between tmem208 and pattern recognition receptors:

    • Toll-like receptors (TLRs)

    • NOD-like receptors (NLRs)

    • RIG-I-like receptors (RLRs)

  • Emergency myelopoiesis: Assess whether tmem208 plays a role in emergency myelopoiesis, the process that replenishes innate immune cells during inflammation .

Experimental Approaches:

  • Use transgenic zebrafish lines with fluorescently labeled immune cells to track immune responses in real-time

  • Employ qPCR for cytokine expression analysis following immune challenges

  • Consider proximity labeling to identify potential tmem208 interactions with immune components

  • Analyze histological samples for evidence of altered inflammatory responses

What imaging techniques can best visualize tmem208 localization and dynamics in zebrafish embryos?

To effectively visualize tmem208 localization and dynamics, researchers should consider these advanced imaging approaches:

Confocal Microscopy Techniques:

  • Fluorescent fusion proteins: Generate tmem208-fluorescent protein fusions (GFP, mCherry) for live imaging

  • Photoactivatable/photoconvertible tags: Use tags like Dendra2 or PA-GFP for pulse-chase experiments tracking protein movement

  • FRAP (Fluorescence Recovery After Photobleaching): Assess protein mobility within membranes

  • Spinning disk confocal microscopy: For rapid acquisition to capture dynamic processes

Super-Resolution Approaches:

  • Structured Illumination Microscopy (SIM): Provides ~120nm resolution to better resolve ER structures

  • Stimulated Emission Depletion (STED): Achieves ~30-80nm resolution for detailed membrane protein organization

  • Single Molecule Localization Microscopy (PALM/STORM): For nanoscale organization analysis

Correlative Light and Electron Microscopy (CLEM):

  • Combine fluorescence imaging with electron microscopy to correlate tmem208 localization with ultrastructural features

  • Use appropriate fixation methods to preserve membrane structures

  • Consider cryo-electron microscopy for near-native state visualization

Sample Preparation Considerations:

  • For whole-mount imaging, ensure proper clearing techniques to improve depth penetration

  • Consider tissue-specific expression systems to reduce background

  • Use appropriate mounting media optimized for the specific imaging modality

  • For multiple color imaging, select fluorophores with minimal spectral overlap

These approaches can reveal not only the subcellular localization of tmem208 but also its dynamics during development and in response to cellular stressors or signaling events.

How can proteomics approaches be optimized for studying tmem208 interactions in zebrafish?

Optimizing proteomics approaches for transmembrane proteins like tmem208 requires specialized strategies to overcome technical challenges:

Sample Preparation Optimization:

  • Membrane protein extraction: Use specialized detergents (DDM, CHAPS, digitonin) that maintain native membrane protein interactions

  • Cross-linking strategies: Apply membrane-permeable cross-linkers (DSP, DSS) to stabilize transient interactions

  • Tissue collection timing: For developmental studies, precisely stage-match embryos and collect sufficient material (typically 200-300 embryos per condition)

  • Subcellular fractionation: Enrich for ER membranes to increase signal-to-noise ratio

Proximity Labeling Optimization:

  • Vector design:

    • Use zebrafish-optimized coding sequences with appropriate Kozak sequences

    • Consider fusion orientation (N- vs C-terminal) based on protein topology

    • Include flexible linkers (GS2) to minimize interference with protein function

  • Expression strategy:

    • Utilize heat shock promoter (HSP70l) for inducible expression

    • Optimize biotin concentration in egg water (recommended: 200 μM)

    • Determine optimal labeling time (12 hours is typically sufficient)

Mass Spectrometry Analysis:

  • Sample processing: Use specialized workflows for membrane proteins:

    • Filter-aided sample preparation (FASP)

    • In-solution digestion with multiple proteases

    • Enrichment of cysteine-containing peptides

  • Statistical analysis:

    • Employ appropriate controls (GFP-fusion proteins)

    • Use statistical scoring to identify significant interactions

    • Consider SAINT, CRAPome, or similar algorithms to filter contaminants

Validation Strategy:

TechniqueApplicationConsiderations
Co-immunoprecipitationConfirm direct interactionsChallenging for membrane proteins
Proximity Ligation AssayVisualize interactions in situRequires specific antibodies
FRET/FLIMAssess direct protein interactionsRequires fluorescent fusion proteins
Genetic interaction studiesFunctional validationPhenotypic analysis of double knockdowns/knockouts

By combining these approaches, researchers can overcome the challenges inherent in studying membrane protein interactions in a developmental model organism .

What computational approaches can help predict tmem208 function and interaction networks?

Computational methods offer powerful ways to predict tmem208 function and interaction networks, complementing experimental approaches:

Structural Prediction and Analysis:

  • Transmembrane domain prediction: Tools like TMHMM, Phobius, or TOPCONS can identify transmembrane segments

  • Protein structure prediction: AlphaFold2 or RoseTTAFold can generate structural models of tmem208

  • Molecular dynamics simulations: Examine membrane insertion and dynamics within a lipid bilayer

  • Ligand binding site prediction: Identify potential functional sites or binding pockets

Evolutionary Analysis:

  • Phylogenetic profiling: Identify co-evolved genes potentially functioning in the same pathway

  • Conserved domain analysis: Recognize functional motifs shared with characterized proteins

  • Selection pressure analysis: Identify constrained regions likely critical for function

  • Synteny analysis: Examine genomic context conservation across species

Network Analysis:

  • Protein-protein interaction predictions: Use tools like STRING, FpClass, or HIPPIE

  • Tissue-specific network construction: Integrate zebrafish transcriptomic data to build context-specific networks

  • Pathway enrichment analysis: Identify biological processes enriched among predicted interactors

  • Network visualization: Use Cytoscape or similar tools for network representation and analysis

Integration with Experimental Data:

  • Proteomics data integration: Incorporate proximity labeling results to refine interaction predictions

  • Expression correlation analysis: Identify genes with similar expression patterns across development

  • Phenotype-based predictions: Compare tmem208 phenotypes with other gene knockouts/knockdowns

  • Literature mining: Automated extraction of relationships from published literature

These computational approaches provide testable hypotheses about tmem208 function and can guide experimental design for functional validation studies.

What emerging technologies could advance our understanding of tmem208 function in zebrafish?

Several cutting-edge technologies show promise for advancing zebrafish tmem208 research:

CRISPR-Based Technologies:

  • Base editing: Introduce specific point mutations without double-strand breaks

  • Prime editing: Precise genome editing with programmable insertions and replacements

  • CRISPRi/CRISPRa: Modulate gene expression without altering sequence

  • CRISPR droplet sequencing: Perform high-throughput screening of tmem208 variants

Advanced Imaging:

  • Lattice light-sheet microscopy: For high-speed, low-phototoxicity imaging of developing embryos

  • Expansion microscopy: Physical expansion of samples for super-resolution imaging with standard equipment

  • 4D imaging: Long-term live imaging throughout development with cell tracking

  • Optogenetics: Control tmem208 function with light-sensitive domains

Single-Cell Technologies:

  • Single-cell RNA-seq: Profile transcriptomic changes in individual cells following tmem208 perturbation

  • Single-cell proteomics: Analyze protein expression at the single-cell level

  • Spatial transcriptomics: Map gene expression changes in tissue context

  • Cell-specific CRISPR: Target tmem208 editing to specific cell populations

Physiological Assessment:

  • Microfluidic organ-on-chip: Culture zebrafish cells in physiologically relevant environments

  • High-throughput behavioral phenotyping: Automated analysis of motor function or other behaviors

  • Intravital microscopy: Image tmem208 dynamics in living zebrafish

  • Electrophysiology: Assess impacts on neural or muscle function

These technologies will enable more precise manipulation and analysis of tmem208 function, potentially revealing new aspects of its biology and disease relevance.

How can researchers resolve contradictory findings in tmem208 research across different model systems?

When faced with contradictory findings about tmem208 across different model systems, researchers should implement a systematic approach:

Standardization and Validation Strategies:

  • Model system comparison: Directly compare zebrafish, fruit fly, and mammalian models using identical experimental conditions

  • Genetic background control: Ensure consistent genetic backgrounds within each model system

  • Cross-validation: Confirm key findings using multiple independent techniques

  • Reagent validation: Verify antibody specificity, morpholino effectiveness, and CRISPR editing efficiency

Addressing Specific Contradictions:

  • Phenotypic differences:

    • Consider developmental timing and stage-specific effects

    • Evaluate tissue-specific phenotypes versus global effects

    • Assess gene dosage effects (hypomorphic versus null alleles)

  • Localization discrepancies:

    • Compare subcellular fractionation with imaging approaches

    • Verify tag position effects (N- versus C-terminal)

    • Assess overexpression artifacts versus endogenous expression

  • Functional interpretation:

    • Distinguish primary from secondary effects through time-course analysis

    • Consider compensatory mechanisms specific to each model organism

    • Evaluate context-dependent functions in different tissues or conditions

Collaborative Approaches:

  • Multi-laboratory validation: Establish collaborations for independent replication

  • Standardized protocols: Develop and share optimized protocols across research groups

  • Data sharing: Create repositories for raw data to enable reanalysis

  • Meta-analysis: Statistically evaluate results across multiple studies

By systematically addressing contradictions, researchers can develop a more comprehensive and accurate understanding of tmem208 biology across different biological contexts.

What are the most promising research avenues for zebrafish tmem208 studies in the next five years?

Based on current findings and technological advances, several research directions show particular promise:

  • Developmental regulation: Characterizing the precise developmental pathways regulated by tmem208, particularly focusing on:

    • Neural development and function, given the seizures observed in human patients

    • Cell polarity establishment during embryogenesis

    • Tissue-specific requirements in different organ systems

  • Protein trafficking mechanisms: Elucidating how tmem208 contributes to endoplasmic reticulum function:

    • Identifying specific cargo proteins dependent on tmem208

    • Characterizing interactions with the secretory pathway machinery

    • Determining if tmem208 forms specialized ER domains

  • Disease modeling: Developing zebrafish models of human TMEM208-related disorders:

    • Creating precise genetic models using CRISPR/Cas9 to introduce patient-specific variants

    • Performing drug screens to identify potential therapeutic compounds

    • Testing genetic modifiers that may ameliorate disease phenotypes

  • Immune system interactions: Exploring potential roles in innate immunity:

    • Investigating responses to various pathogens in tmem208-deficient zebrafish

    • Examining potential interactions with pattern recognition receptors

    • Studying effects on inflammatory signaling pathways

  • Interactome mapping: Comprehensive characterization of the tmem208 protein interaction network:

    • Implementing optimized proximity labeling approaches

    • Conducting tissue- and stage-specific interactome analyses

    • Integrating findings with human disease genetics

These research avenues will likely provide significant insights into both basic biology and potential therapeutic applications for TMEM208-related human diseases.

What standardized protocols should be established for consistent tmem208 research in zebrafish?

To ensure reproducibility and facilitate comparison across studies, the following standardized protocols should be established:

Genetic Manipulation Protocols:

  • CRISPR/Cas9 knockout generation:

    • Validated guide RNA sequences targeting conserved exons

    • Standardized screening and genotyping methods

    • Established outcrossing procedures to remove off-target effects

  • Transgenic line creation:

    • Optimized vector designs with consistent promoters and tags

    • Validated integration site screening approaches

    • Standardized expression validation methods

Expression Analysis Standards:

  • RNA detection:

    • Validated primer sets for qPCR

    • Optimized in situ hybridization protocols

    • Standardized RNA-seq analysis pipelines

  • Protein detection:

    • Validated antibodies or epitope tagging approaches

    • Standardized western blot protocols optimized for membrane proteins

    • Consistent immunohistochemistry procedures

Phenotypic Analysis Guidelines:

  • Developmental assessment:

    • Standardized staging criteria

    • Consistent morphological evaluation parameters

    • Quantitative scoring systems for phenotypic severity

  • Functional assays:

    • Standardized behavioral tests

    • Consistent imaging parameters for morphological analysis

    • Validated physiological measurement techniques

Data Reporting Standards:

Data TypeRequired InformationFormat
Genetic modelsExact sequence changes, background strain, generationSequence files + text description
Expression analysisSample sizes, normalization methods, statistical testsRaw data + processed results
ImagingAcquisition parameters, processing steps, quantification methodsOriginal images + analyzed data
Phenotypic dataScoring criteria, sample sizes, blinding proceduresRaw measurements + statistical analysis

Establishing these standardized protocols will enhance reproducibility and accelerate progress in understanding zebrafish tmem208 biology and its relevance to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.