Recombinant Danio rerio Transmembrane protein 218 (tmem218)

Shipped with Ice Packs
In Stock

Description

Introduction to tmem218 in Danio rerio

Transmembrane protein 218 (tmem218) is encoded by the tmem218 gene in the zebrafish genome. This protein belongs to a conserved family of transmembrane proteins found across vertebrate species. The zebrafish tmem218 gene (ID: 393369) is also known by the synonym zgc:63675 . The protein is cataloged in various scientific databases with identifiers such as UniProt ID Q7SZ56 and RefSeq Accession NP_956692.1 .

Basic Information on tmem218 Gene and Protein

ParameterInformationSource
Gene Symboltmem218
Gene ID393369
Synonymszgc:63675
Gene TypeProtein-coding
OrganismDanio rerio (zebrafish)
UniProt IDQ7SZ56
RefSeq AccessionNP_956692.1

Available Recombinant Products

Several recombinant forms of Danio rerio tmem218 are commercially available for research purposes. These products enable scientists to perform various investigations into the structure, function, and interactions of this protein.

Catalog NumberProduct NameTagExpression SystemSource
RFL16018DFRecombinant Full Length Danio Rerio Transmembrane Protein 218(Tmem218) ProteinHis-TaggedNot specified
TMEM218-10712ZRecombinant Zebrafish TMEM218Not specifiedNot specified

Ciliary Functions and Localization

Research indicates that tmem218 plays a significant role in ciliary biogenesis and function . Cilia are evolutionarily conserved cellular organelles that participate in cellular sensing, movement, and signaling across diverse cell types. The protein localizes to the ciliary transition zone (TZ), a specialized compartment at the base of the cilium that controls the traffic of proteins in and out of cilia .

The importance of tmem218 in ciliary function is underscored by its characterization as a major component of the ciliary transition zone module. This localization positions tmem218 at a critical interface for regulating ciliary composition and function, highlighting its potential significance in both normal cellular processes and disease states .

Protein Interactions

Co-immunoprecipitation studies have identified physical interactions between tmem218 and other ciliary proteins, providing insights into its functional network:

Interaction PartnerModuleFunctional SignificanceSource
TMEM67/MeckelinMKS moduleCritical for ciliary function; interaction reduced by disease-causing mutations
Nphp4NPHP moduleGenetic interaction produces ciliopathy phenotypes in zebrafish

These interactions suggest that tmem218 functions within a larger protein complex at the ciliary transition zone, collaborating with other proteins to maintain proper ciliary structure and function. The disruption of these interactions, as observed with disease-causing mutations, can lead to ciliary dysfunction and associated pathologies .

Functional Studies

Recombinant Danio rerio tmem218 serves as a valuable tool for investigating protein function through multiple experimental approaches:

  1. In vitro binding assays to identify and characterize interaction partners

  2. Structure-function analyses to determine critical domains for protein activity

  3. Cell-based assays to assess the effect on ciliary formation and function

  4. Development of antibodies for localization studies and protein detection

  5. Reconstitution experiments to demonstrate functional activity

These applications enable researchers to dissect the molecular mechanisms underlying tmem218 function in ciliary biology and potentially identify intervention points for ciliopathy-related diseases.

Disease Modeling

Zebrafish has been established as an excellent model organism for studying ciliopathies, with tmem218 playing a significant role:

FindingDescriptionSource
Ciliopathy PhenotypesManipulation of tmem218 in zebrafish produces phenotypes similar to human ciliopathies
Genetic InteractionsSynergistic interaction between tmem218 and the NPHP module component Nphp4 crucial for ciliary function
Human Disease CorrelationMutations in TMEM218 linked to syndromes with features of Bardet-Biedl, Joubert, and Meckel-Gruber syndromes

The availability of recombinant Danio rerio tmem218 facilitates these disease modeling studies by providing a reference protein for structural and functional comparisons with mutant forms. This approach has proven valuable for validating the pathogenicity of TMEM218 mutations identified in patients with ciliopathies .

Comparison with Human TMEM218

The conservation of tmem218 between zebrafish and humans makes zebrafish a valuable model for studying human TMEM218-related conditions. This evolutionary conservation provides a strong foundation for translational research from zebrafish to human applications.

FeatureZebrafish tmem218Human TMEM218Source
Gene ID393369219854
FunctionCiliary biogenesis and functionCiliary biogenesis and function
Disease AssociationCiliopathy phenotypes in animal modelsCiliopathy phenotypes in patients
Interaction PartnersTMEM67, Nphp4TMEM67

The functional and structural similarities between zebrafish and human TMEM218 suggest that insights gained from studies with recombinant Danio rerio tmem218 may have direct relevance to understanding human ciliopathies and developing potential therapeutic approaches.

Conservation Across Species

The tmem218 protein shows conservation across vertebrate species, indicating its evolutionary importance and functional significance:

SpeciesProduct Catalog NumberSource
HumanTMEM218-4209H, TMEM218-1788H
RatTMEM218-5811R, RFL17816RF
MouseTMEM218-16998M, TMEM218-9360M
BovineRFL22711BF
ZebrafishRFL16018DF, TMEM218-10712Z

This cross-species conservation provides a strong rationale for using Danio rerio as a model organism for studying tmem218 function, as findings may have broad implications across vertebrate biology.

Key Discoveries

Recent research has provided significant insights into the function and importance of tmem218:

FindingDescriptionSource
Disease GeneTMEM218 identified as a new disease gene for patients with syndromic ciliopathy phenotypes
Transition Zone ComponentTMEM218 characterized as a major component of the ciliary transition zone module
Protein InteractionsPhysical interaction with TMEM67/Meckelin that is reduced by disease-causing mutations
Synergistic InteractionsEvidence for synergistic interaction with NPHP module crucial for proper ciliary function

These findings have established tmem218 as an important player in ciliary biology and human disease, highlighting the value of continued research using recombinant forms of the protein.

Functional Validation in Zebrafish

Zebrafish has served as a well-established vertebrate model for validating the pathogenicity of TMEM218 mutations and studying ciliopathy-related phenotypes . In particular, research has demonstrated that ciliopathy-related phenotypes were most prominent when tmem218 had genetic interactions with Nphp4, a component of the NPHP module. This synergistic interaction was found to be crucial for proper ciliary function, providing important insights into the molecular mechanisms underlying ciliopathies .

The ability to observe and quantify these phenotypes in zebrafish underscores the value of this model organism for studying tmem218 function and validates the relevance of recombinant Danio rerio tmem218 for both basic and translational research.

Therapeutic Applications

Understanding the structure and function of tmem218 using recombinant proteins may lead to several potential therapeutic applications:

  1. Development of targeted therapies for ciliopathies through modulation of tmem218 function

  2. Screening of compounds that restore function to mutant tmem218 or compensate for its loss

  3. Gene therapy approaches for tmem218-related conditions

  4. Identification of downstream effectors that might serve as alternative therapeutic targets

Recombinant Danio rerio tmem218 provides an essential tool for these investigations, offering a stable and well-characterized protein for in vitro studies and screening assays.

Expanded Applications in Developmental Biology

Given its role in ciliary function, further research with recombinant tmem218 could illuminate several aspects of developmental biology:

  1. Its influence on zebrafish embryonic development and organogenesis

  2. Role in specific tissues and organs during development

  3. Temporal expression patterns and regulation during different developmental stages

  4. Contribution to left-right asymmetry and other ciliary-dependent developmental processes

These investigations would not only enhance our understanding of tmem218 function but also provide broader insights into the role of ciliary proteins in vertebrate development.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
tmem218; zgc:63675; Transmembrane protein 218
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem218
Target Protein Sequence
MADVVLGVGTGVFIITLIWILTLALTIILSRATGPTKLGIIPVVLLALIITLVLVFFPRA AEVPAPQRAAQIVDMFFIGRYVLLSLVSLVFLAALFMLLPLHFLEPIYAKPLRTH
Uniprot No.

Target Background

Function
May be involved in ciliary biogenesis or function.
Database Links
Protein Families
TMEM218 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is TMEM218 and what is its fundamental role in ciliary biology?

TMEM218 is a transmembrane protein that functions as a major component of the ciliary transition zone (TZ) module. It is located at the periphery of the TZ, potentially forming part of the ciliary necklace structure, which consists of particles encircling the cilium near its base . TMEM218 plays a crucial role in maintaining proper ciliary function, as demonstrated by studies showing that mutations in the TMEM218 gene can lead to ciliopathies characterized by dysfunctional cilia . At the molecular level, TMEM218 interacts with other TZ proteins to form a functional module that contributes to the compartmentalization of the cilium and regulation of protein trafficking across the TZ . The protein is part of a distinct module at the utmost periphery of the TZ, alongside other transmembrane proteins including TMEM216, TMEM231, TMEM80, TMEM17, and TMEM237 .

Why is Danio rerio considered an effective model organism for studying TMEM218 function?

Danio rerio (zebrafish) is established as a well-validated vertebrate model for ciliopathy research, including studies of TMEM218 function, for several compelling reasons:

  • Evolutionary conservation: The ciliary transition zone is evolutionarily conserved across species, making zebrafish an appropriate model for studying human ciliopathies .

  • Functional validation: Research has demonstrated that zebrafish can effectively validate the pathogenicity of TMEM218 mutations identified in human patients with ciliopathies .

  • Visible phenotypes: Ciliopathy-related phenotypes are readily observable in zebrafish models, allowing researchers to assess the functional impact of TMEM218 dysfunction .

  • Genetic tractability: Zebrafish are amenable to genetic manipulation, enabling the creation of knockdown or knockout models to study TMEM218 function .

  • Optical transparency: The transparency of zebrafish embryos facilitates in vivo imaging of ciliary structures and protein localization.

The effectiveness of this model has been demonstrated in research validating the pathogenicity of TMEM218 missense changes harbored by patients with ciliopathy phenotypes .

What methods are commonly employed to express recombinant TMEM218 in zebrafish models?

Researchers typically employ several methodologies to express recombinant TMEM218 in zebrafish models:

Microinjection Techniques:

  • mRNA injection: Synthetic TMEM218 mRNA is injected into embryos at the 1-4 cell stage for transient expression

  • DNA constructs: Plasmids containing TMEM218 under tissue-specific promoters can be microinjected

  • Morpholino oligonucleotides: For knockdown studies to assess loss-of-function phenotypes

  • CRISPR/Cas9 components: For genome editing to create stable transgenic or knockout lines

Expression Vectors:

  • Gateway-compatible vectors for creating fusion proteins with fluorescent tags (GFP, mCherry)

  • Tol2 transposon-based vectors for more efficient genomic integration and stable expression

For functional analysis of TMEM218 variants identified in patients, researchers often perform rescue experiments, injecting wild-type or mutant forms of TMEM218 mRNA into TMEM218-deficient zebrafish to assess phenotypic rescue capabilities .

How can researchers effectively visualize TMEM218 localization in zebrafish ciliary structures?

Visualization of TMEM218 localization in zebrafish requires specialized techniques due to the small size and specific location of the ciliary transition zone. Recommended approaches include:

Immunofluorescence Methods:

  • Fixed tissue immunostaining using antibodies against TMEM218 and co-staining with other transition zone markers

  • Use of fluorescently tagged TMEM218 (e.g., GFP-TMEM218) expressed from injected constructs

  • Confocal microscopy with high-resolution objectives (63x or 100x) for detailed imaging of ciliary structures

Advanced Imaging Techniques:

  • Super-resolution microscopy has revealed important details of transition zone organization, showing that TMEM218 localizes to concentric ring structures at the periphery of the TZ

  • Live imaging in transparent zebrafish embryos to track TMEM218 dynamics

When visualizing TMEM218, researchers typically use markers for basal bodies (e.g., gamma-tubulin), axonemes (e.g., acetylated tubulin), and other TZ proteins to provide contextual information about TMEM218's precise localization within the ciliary compartment.

What protein interactions of TMEM218 have been identified in zebrafish models?

Research has identified several key protein interactions of TMEM218 in zebrafish models that are critical for proper ciliary function:

Confirmed Protein Interactions:

  • TMEM67/Meckelin: Co-immunoprecipitation assays have demonstrated physical interaction between TMEM218 and TMEM67/Meckelin, which is a member of the MKS (Meckel-Gruber syndrome) module

  • Nphp4: Significant genetic interactions between TMEM218 and the NPHP module component Nphp4 have been observed, with ciliopathy-related phenotypes being most prominent when both are affected

Functional Module Associations:

  • TMEM218 functions as part of a distinct module at the periphery of the transition zone, alongside other transmembrane proteins including TMEM216, TMEM231, TMEM80, TMEM17, and TMEM237

These interactions suggest that TMEM218 works synergistically with components of both the MKS and NPHP modules to maintain proper ciliary function. The pathogenicity of certain TMEM218 missense mutations has been confirmed by demonstrating reduced interaction with TMEM67/Meckelin in patient samples .

What are the critical experimental considerations when designing TMEM218 knockdown or knockout studies in zebrafish?

When designing TMEM218 knockdown or knockout studies in zebrafish, researchers should consider several critical factors to ensure robust and interpretable results:

Genetic Modification Approaches:

  • Morpholino design: Target specificity is crucial; researchers should design morpholinos targeting the translation start site or splice junctions of TMEM218, with appropriate controls to rule out off-target effects

  • CRISPR/Cas9 strategy: Multiple guide RNAs targeting different exons should be tested, with careful validation of editing efficiency

  • Rescue experiments: Wild-type TMEM218 mRNA should be co-injected to confirm phenotype specificity

Phenotypic Analysis:

  • Developmental timing: Assessment at multiple developmental stages is necessary as ciliopathy phenotypes may manifest differently over time

  • Tissue-specific effects: Examination of multiple ciliated tissues (brain, kidney, retina) is important as TMEM218 dysfunction may affect different organs with varying severity

Controls and Validation:

  • Dosage optimization: Titration experiments to determine appropriate morpholino or Cas9/gRNA concentrations

  • Protein depletion verification: Western blot or immunostaining to confirm TMEM218 reduction

  • Specificity controls: Use of mismatch morpholinos or unrelated guide RNAs as negative controls

The synergistic interaction between TMEM218 and the NPHP module component Nphp4 should be considered in experimental design, as ciliopathy-related phenotypes have been shown to be most prominent when both are affected .

How can researchers differentiate between primary and secondary effects of TMEM218 dysfunction in zebrafish models?

Distinguishing primary from secondary effects of TMEM218 dysfunction requires a multi-faceted experimental approach:

Temporal Analysis Strategies:

  • Time-course experiments: Monitor phenotype progression from earliest detectable change

  • Inducible systems: Use heat-shock or chemical-inducible promoters to control TMEM218 expression at specific developmental stages

  • Early molecular markers: Assess immediate transcriptional/proteomic changes before morphological phenotypes appear

Mechanistic Verification Methods:

  • Rescue experiments: Selective restoration of specific pathways to determine which effects can be reversed

  • Protein localization studies: Track mislocalization of known TZ partners as immediate consequences of TMEM218 loss

  • Epistasis analysis: Knockdown potential downstream effectors in TMEM218-deficient background to test dependency relationships

Comparative Analysis Approaches:

  • Cross-comparison with other ciliopathy models: Identify common vs. model-specific effects

  • Tissue-specific analysis: Compare effects across different ciliated tissues to identify consistent primary defects

Researchers should focus on the known physical interaction between TMEM218 and TMEM67/Meckelin as a potential primary effect, as this interaction has been shown to be significantly reduced by pathogenic TMEM218 missense mutations . Secondary effects might then manifest as downstream consequences of disrupted transition zone integrity.

What methodologies are most effective for studying genetic interactions between TMEM218 and other ciliary proteins in zebrafish?

Several sophisticated methodologies have proven effective for investigating genetic interactions between TMEM218 and other ciliary proteins in zebrafish:

Combinatorial Knockdown/Knockout Approaches:

  • Sub-threshold double knockdowns: Injection of low-dose morpholinos targeting TMEM218 and potential interactors (particularly Nphp4) to identify synergistic effects

  • CRISPR multiplexing: Simultaneous targeting of TMEM218 and partner genes using pooled guide RNAs

  • Compound heterozygote analysis: Crossing heterozygous mutant lines to assess genetic interaction in trans

Protein-Protein Interaction Analysis:

  • In vivo proximity labeling: BioID or APEX2 fusion proteins to identify proximal proteins in the native environment

  • Co-immunoprecipitation from zebrafish tissues: Followed by mass spectrometry to identify interaction partners

  • Förster Resonance Energy Transfer (FRET): For studying direct protein interactions in live zebrafish embryos

Quantitative Phenotypic Assessment:

  • Modifier screens: Testing whether mutations in other genes enhance or suppress TMEM218 mutant phenotypes

  • Quantitative trait analysis: Measuring severity of phenotypes across genetic combinations

  • High-content imaging: Automated analysis of multiple phenotypic parameters

The genetic interaction between TMEM218 and Nphp4 should be a primary focus, as research has demonstrated that ciliopathy-related phenotypes are most prominent when both are affected . This suggests that TMEM218 functions synergistically with the NPHP module to maintain proper ciliary function.

How can zebrafish TMEM218 studies be effectively translated to understand human ciliopathies?

Translating findings from zebrafish TMEM218 studies to human ciliopathies requires systematic approaches that bridge model organism biology with clinical research:

Patient Variant Validation Framework:

  • Functional assessment of patient mutations: Introduction of equivalent mutations in zebrafish TMEM218 to assess functional consequences

  • Rescue experiments: Testing whether human TMEM218 can compensate for zebrafish TMEM218 deficiency

  • Phenotypic correlation: Mapping zebrafish phenotypes to specific human ciliopathy features

Comparative Analysis Methods:

  • Multi-species protein interaction networks: Comparing TMEM218 interactors across zebrafish and human cells

  • Conservation mapping: Identifying highly conserved functional domains as likely pathogenic mutation hotspots

  • Tissue-specific expression comparison: Aligning zebrafish TMEM218 expression patterns with human expression data

Translational Research Approaches:

  • Patient-derived cells with zebrafish models: Parallel studies in patient fibroblasts and zebrafish

  • Small molecule screening: Using zebrafish models to identify compounds that rescue TMEM218-related phenotypes

  • CRISPR-engineered fish mimicking exact patient mutations: For precise modeling of human conditions

Research has already demonstrated the translational value of zebrafish models, as studies have used zebrafish to validate the pathogenicity of TMEM218 missense mutations identified in patients with Bardet-Biedl, Joubert, and Meckel-Gruber syndrome features .

What are the current challenges and future directions in TMEM218 research using zebrafish models?

Current challenges and emerging opportunities in TMEM218 zebrafish research include:

Technical Challenges:

  • Protein detection limitations: Developing highly specific antibodies against zebrafish TMEM218 for improved detection of endogenous protein

  • Sub-cellular resolution: Need for improved imaging techniques to visualize TZ ultrastructure in vivo

  • Temporal control: More precise methods for stage-specific manipulation of TMEM218 function

Knowledge Gaps:

  • Regulatory mechanisms: Limited understanding of factors controlling TMEM218 expression and localization

  • Tissue-specific functions: Incomplete characterization of potential tissue-specific roles in different ciliated cell types

  • Dynamic interactions: Need for better understanding of how TMEM218 interactions change during ciliogenesis and ciliary function

Future Research Directions:

  • Single-cell approaches: Applying transcriptomics and proteomics at single-cell resolution to identify cell-type-specific responses to TMEM218 dysfunction

  • Super-resolution microscopy: Further application of advanced imaging to elucidate the precise organization of TMEM218 within the TZ structure

  • Integration with other models: Combining zebrafish studies with mammalian cell culture and mouse models for comprehensive understanding

Emerging Methodologies:

  • Optogenetic tools: For spatial and temporal control of TMEM218 function in specific cell types

  • In vivo proximity labeling: To map the dynamic TMEM218 interactome in different tissues and developmental stages

  • Cryo-electron tomography: To visualize TMEM218's precise position within the transition zone architecture

Research has shown that TMEM218 may be part of the ciliary necklace and is organized into concentric ring structures at the TZ periphery , but detailed structural information remains limited. Future studies should focus on better understanding the three-dimensional organization of TMEM218 within the transition zone and its dynamic interactions during cilium formation and function.

What phenotypes are associated with TMEM218 dysfunction in zebrafish models?

Zebrafish models with TMEM218 dysfunction display a range of ciliopathy-related phenotypes that correlate with human disease manifestations:

Observed Phenotypes in Zebrafish Models:

  • Ciliary dysfunction in multiple tissues

  • Developmental abnormalities consistent with ciliopathy phenotypes

  • Synergistic effects when combined with dysfunction of other ciliary proteins, particularly Nphp4

These phenotypes in zebrafish have been instrumental in validating the pathogenicity of TMEM218 mutations identified in human patients . The specificity of these phenotypes is confirmed through rescue experiments, where reintroduction of wild-type TMEM218 can ameliorate the defects caused by TMEM218 deficiency.

What is the molecular basis for TMEM218-associated ciliopathies?

The molecular mechanisms underlying TMEM218-associated ciliopathies involve disruption of transition zone architecture and function:

Molecular Mechanisms:

  • Disrupted protein interactions: Pathogenic mutations in TMEM218 reduce physical interaction with TMEM67/Meckelin, a member of the MKS module

  • Transition zone integrity: TMEM218 dysfunction compromises the compartmentalization function of the TZ

  • Module cooperation: Evidence suggests synergistic interaction between TMEM218 and the NPHP module is crucial for proper ciliary function

Structural Considerations:

  • TMEM218 is part of a distinct module at the periphery of the TZ, potentially comprising part of the ciliary necklace

  • The protein is organized into concentric ring structures at the TZ

The precise positioning of TMEM218 within the TZ architecture is critical to its function, as it works with other TZ proteins to maintain the compartmentalization of the cilium and regulate protein trafficking across this important boundary region.

What clinical spectrum is associated with TMEM218 mutations in humans?

Human patients with biallelic TMEM218 mutations present with a spectrum of ciliopathy phenotypes ranging from Joubert syndrome to the more severe Meckel syndrome:

Clinical Manifestations Table:

FeatureFrequencyNotes
Molar tooth signN=2 (living individuals)Classic brain MRI finding in Joubert syndrome
Occipital encephaloceleN=5 (all fetuses)Characteristic of Meckel syndrome
Retinal dystrophyN=4 (all living individuals)Ranging from Leber congenital amaurosis to early-onset rod-cone dystrophy
Polycystic kidneysN=2Observed in fetuses with Meckel syndrome diagnosis
PolydactylyN=2Observed in fetuses with Meckel syndrome diagnosis
Developmental disabilityN=4 (all living individuals)Ranging from full dependence to near independence for activities of daily living
Hypoplastic left heart syndromeN=1Characterized by absent mitral valve, small left ventricle, and other cardiac abnormalities

Notably, four of the six affected families identified in research carry missense variants affecting the same highly conserved amino acid position 115 , suggesting this is a mutational hotspot with significant functional importance.

How do studies in zebrafish complement human genetic findings on TMEM218?

Zebrafish studies have provided crucial functional validation for TMEM218 mutations identified in human patients:

Complementary Research Approaches:

  • Mutation validation: Zebrafish models have confirmed the pathogenicity of TMEM218 missense changes harbored by patients with ciliopathy phenotypes

  • Functional analysis: Studies in zebrafish have demonstrated that TMEM218 is a major component of the ciliary TZ module

  • Genetic interaction studies: Zebrafish research has revealed important synergistic interactions between TMEM218 and the NPHP module component Nphp4

The zebrafish model has been particularly valuable because:

  • It allows in vivo assessment of ciliary function in a vertebrate system

  • It enables visualization of developmental phenotypes associated with ciliary dysfunction

  • It facilitates testing of genetic interactions that may modify disease severity

Through these complementary approaches, researchers have established TMEM218 as a disease gene for patients with a wide spectrum of syndromic ciliopathy phenotypes and provided evidence for synergistic interactions crucial for proper ciliary function .

What are the recommended protocols for generating TMEM218 knockout or knockdown in zebrafish?

Researchers have several options for generating TMEM218-deficient zebrafish models, each with specific technical considerations:

CRISPR/Cas9 Knockout Protocol:

  • Guide RNA design: Target conserved exons (preferably early exons) using established zebrafish genome databases

  • Microinjection: Inject 1-cell stage embryos with Cas9 protein (300-500 ng/μL) and guide RNA (50-100 ng/μL)

  • Mutation screening: Use T7 endonuclease assay or direct sequencing to identify mutations

  • Founder identification: Raise F0 fish and screen for germline transmission

  • Line establishment: Outcross founders to generate stable lines with defined mutations

Morpholino Knockdown Approach:

  • Morpholino design: Target translation start site or splice junctions of TMEM218

  • Dosage determination: Test concentration range (typically 2-8 ng) to identify effective dose with minimal toxicity

  • Controls: Include mismatch morpholino and rescue with TMEM218 mRNA

  • Knockdown validation: Confirm protein reduction by Western blot or immunostaining

  • Phenotype assessment: Evaluate ciliary structure and function in relevant tissues

When designing these experiments, researchers should consider the synergistic interaction between TMEM218 and the NPHP module component Nphp4, as ciliopathy-related phenotypes have been shown to be most prominent when both are affected .

What imaging techniques are most informative for studying TMEM218 localization and function?

Advanced imaging approaches provide crucial insights into TMEM218 localization and function in zebrafish:

Recommended Imaging Techniques:

  • Confocal microscopy: For co-localization studies with other TZ proteins

  • Super-resolution microscopy: To resolve the concentric ring structures at the TZ where TMEM218 localizes

  • Live imaging: In transparent zebrafish embryos using fluorescently tagged TMEM218

  • Transmission electron microscopy: For ultrastructural analysis of the TZ in TMEM218-deficient cilia

  • Correlative light and electron microscopy (CLEM): To precisely position TMEM218 within the TZ ultrastructure

Ciliary Visualization Protocol:

  • Sample preparation: Fix embryos at appropriate developmental stages

  • Immunostaining: Label with antibodies against TMEM218 and markers for different ciliary compartments

  • Mounting: Orient samples for optimal visualization of ciliated tissues

  • Imaging parameters: Use appropriate resolution and z-stack intervals to capture entire ciliary structures

  • Analysis: Apply 3D reconstruction and quantitative analysis of protein localization

Recent advances in super-resolution microscopy have been particularly valuable for studying TZ organization, revealing that TMEM218 is part of a distinct module at the periphery of the TZ, potentially comprising part of the ciliary necklace structure .

What biochemical assays are effective for studying TMEM218 protein interactions?

Several biochemical approaches have proven effective for investigating TMEM218 protein interactions:

Co-Immunoprecipitation Methods:

  • Traditional co-IP: Has successfully demonstrated physical interaction between TMEM218 and TMEM67/Meckelin

  • Tandem affinity purification: For identifying stable protein complexes containing TMEM218

  • Crosslinking-assisted IP: To capture transient or weak interactions

Proximity-Based Interaction Assays:

  • BioID or TurboID: Fusion of biotin ligase to TMEM218 for proximity labeling

  • APEX2 proximity labeling: For electron microscopy-compatible labeling of neighboring proteins

  • Split-GFP complementation: For visualizing interactions in living zebrafish embryos

Quantitative Interaction Analysis:

  • Surface plasmon resonance: For measuring binding affinities between purified proteins

  • Microscale thermophoresis: For interaction studies using minimal protein amounts

  • FRET-based assays: For studying interactions in cellular contexts

Co-immunoprecipitation assays have already yielded important insights, demonstrating that pathogenic TMEM218 missense mutations can significantly reduce the physical interaction with TMEM67/Meckelin , providing a molecular mechanism for disease pathogenesis.

How can researchers effectively model TMEM218 patient mutations in zebrafish?

Modeling patient-specific TMEM218 mutations in zebrafish requires careful experimental design:

CRISPR-Based Precise Editing:

  • HDR template design: Create repair template containing patient mutation with ~800 bp homology arms

  • Microinjection: Co-inject with Cas9/gRNA targeting the region of interest

  • Founder screening: Use restriction digest, high-resolution melting analysis, or sequencing

  • Phenotypic analysis: Compare to complete knockout and wild-type controls

mRNA-Based Functional Analysis:

  • Construct generation: Create expression vectors with wild-type or mutant TMEM218

  • Rescue experiments: Inject mRNA into TMEM218-deficient embryos

  • Functional assessment: Quantify degree of phenotypic rescue

  • Protein interaction studies: Test effect of mutations on known protein interactions

This approach has been successfully used to validate the pathogenicity of TMEM218 missense changes harbored by patients with ciliopathy phenotypes . Notably, four of the six families affected by TMEM218-related ciliopathies carry missense variants affecting the same highly conserved amino acid position 115 , making this position a priority target for functional studies.

What emerging technologies might advance TMEM218 research in zebrafish models?

Several cutting-edge technologies show promise for advancing TMEM218 research in zebrafish:

Single-Cell Technologies:

  • Single-cell RNA-seq: To identify cell type-specific responses to TMEM218 dysfunction

  • Spatial transcriptomics: For mapping gene expression changes in specific tissues of TMEM218-deficient fish

  • CyTOF: For high-dimensional protein analysis at single-cell resolution

Advanced Genome Engineering:

  • Base editing: For precise introduction of patient mutations without DNA cleavage

  • Prime editing: For installing specific mutations with minimal off-target effects

  • Inducible CRISPR systems: For temporal control of TMEM218 disruption

Novel Imaging Approaches:

  • Lattice light-sheet microscopy: For high-speed, low-phototoxicity imaging of ciliary dynamics

  • Expansion microscopy: For physical magnification of ciliary structures

  • Cryo-electron tomography: For near-atomic resolution of TZ architecture

These technologies could help resolve remaining questions about TMEM218 function, particularly regarding its precise localization within the TZ structure and its dynamic interactions during ciliogenesis and ciliary function.

What are the potential therapeutic implications of TMEM218 research?

Research on TMEM218 and its role in ciliopathies has several potential therapeutic implications:

Therapeutic Development Approaches:

  • Gene therapy: Targeted delivery of functional TMEM218 to affected tissues

  • Protein replacement: Development of methods to deliver recombinant TMEM218 protein

  • Small molecule screening: Using zebrafish models to identify compounds that rescue TMEM218-related phenotypes

Precision Medicine Applications:

  • Mutation-specific therapy: Developing approaches targeting specific TMEM218 variants

  • Genetic modifiers: Identifying and targeting modifiers that affect disease severity

  • Combinatorial therapy: Addressing multiple ciliary components based on genetic interaction data

Clinical Translation Considerations:

  • Biomarker development: Identifying measurable indicators of TMEM218 dysfunction

  • Early intervention: Developing therapies that could be applied before irreversible tissue damage

  • Tissue-specific approaches: Targeting interventions to most severely affected tissues

Understanding the synergistic interaction between TMEM218 and other ciliary proteins, particularly NPHP4 , could lead to novel therapeutic strategies targeting these interactions or their downstream effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.