Recombinant Danio rerio Transmembrane protein 229b (tmem229b)

Shipped with Ice Packs
In Stock

Description

Gene Information

ParameterValueSource
Gene Symboltmem229b
Entrez Gene ID767735
Synonymszgc:153098
OrganismDanio rerio (zebrafish)
Gene TypeProtein-coding

The tmem229b gene encodes a transmembrane protein with a predicted role in cellular membrane processes. While its exact function in zebrafish remains understudied, orthologs in humans (TMEM229B) are linked to glucose metabolism, apoptosis, and cancer biology .

Functional Studies

Recombinant tmem229b is used to:

  1. Investigate Transmembrane Signaling: As a transmembrane protein, tmem229b may regulate cell-cell communication or ion transport. Studies in zebrafish models could elucidate its role in developmental processes.

  2. Model Human Diseases: While human TMEM229B is implicated in diabetes and cancer , zebrafish models may provide insights into conserved pathways. For example, tmem229b knockdown/downregulation in zebrafish could mimic diabetic or tumorigenic states.

  3. Protein Interaction Mapping: Yeast two-hybrid or co-IP assays using recombinant tmem229b can identify binding partners critical for its function.

Potential in Vaccine Development

Human TMEM229B has been proposed as a potential antigen in mRNA vaccines for esophageal squamous cell carcinoma . Zebrafish-derived tmem229b may serve as a model to test vaccine efficacy or immunogenicity in aquatic species.

Current Limitations

  • Limited Functional Data: Most studies on TMEM229B focus on human or rodent models . Zebrafish-specific research is sparse, with no published studies directly linking tmem229b to physiological or pathological processes.

  • Structural Insights: The tertiary structure of tmem229b remains uncharacterized, hindering mechanistic studies.

Proposed Research Priorities

  1. Functional Knockout Studies: CRISPR-Cas9-mediated gene editing in zebrafish to assess tmem229b phenotypes.

  2. Expression Profiling: Tissue-specific expression analysis to identify tmem229b’s role in organ development or disease.

  3. Comparative Genomics: Alignment of zebrafish tmem229b with human orthologs to predict conserved domains or motifs.

Table 1: Comparative Analysis of TMEM229B Orthologs

OrganismGene IDTissue ExpressionAssociated Pathways
HumanQ8NBD8Parathyroid, skin, thyroid Glucose metabolism, apoptosis
Zebrafish767735Not reportedHypothetical (membrane signaling)
Rat1562622Pancreas, liver Diabetes, cancer

Table 2: Applications of Recombinant tmem229b

ApplicationMethodologyPurpose
Protein PurificationAffinity chromatographyStructural studies
Vaccine Antigen TestingImmunization assaysVaccine development (hypothetical)
Gene Expression AnalysisqPCR, Western blottingFunctional genomics

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference for your specific needs.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem229b; zgc:153098; Transmembrane protein 229b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem229b
Target Protein Sequence
MATTVTPEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNCNWKFPGVTSVWALFIYGTCI LIVERMYLCLKDRCNVLLRCIIYTLWTYFWEFGTGFLLRQFNACPWDYSEFKYNFMGLIT AEYAVPWFCASFIVERLVIRNTLRLRFDEVAESGQAEERLDRGGGGRGGRRGRGARAGAT SANGYVKVD
Uniprot No.

Target Background

Database Links

KEGG: dre:767735

UniGene: Dr.159960

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 229b (tmem229b) in zebrafish and why is it significant for research?

Transmembrane protein 229b (tmem229b) is a membrane-spanning protein expressed in Danio rerio (zebrafish) with the UniProt accession number Q08CG9. This protein belongs to the broader family of transmembrane proteins that are crucial for cellular functions including signaling, transport, and response to environmental stressors. While tmem229b-specific research is still emerging, the significance of transmembrane proteins in zebrafish has been established through studies on related proteins such as tmem39b, which has been shown to play roles in protecting cells against DNA damage during stress responses . To study tmem229b function, researchers should consider comparative analyses with other transmembrane proteins using gene expression studies across different brain regions and under various stress conditions, similar to methodologies employed for related proteins .

What are the optimal storage conditions for preserving Recombinant Danio rerio tmem229b activity?

For optimal preservation of Recombinant Danio rerio tmem229b activity, the protein should be stored in Tris-based buffer with 50% glycerol, which is specifically optimized for this protein's stability . For short-term storage, maintain working aliquots at 4°C for up to one week. For extended storage, keep the protein at -20°C, while for long-term preservation, -80°C is recommended . To prevent protein degradation and loss of activity, repeated freeze-thaw cycles should be avoided, as this can cause denaturation and aggregation. Instead, prepare multiple small aliquots upon initial thawing to minimize the number of freeze-thaw cycles each sample experiences. This storage protocol is similar to that used for other zebrafish transmembrane proteins in experimental studies .

What gene expression analysis techniques are most effective for studying tmem229b in zebrafish?

For effective gene expression analysis of tmem229b in zebrafish, quantitative real-time PCR (qRT-PCR) using the BioMark system with SsoFast EvaGreen Supermix remains the gold standard when studying specific brain regions or tissues . When designing such experiments, researchers should:

  • Extract total RNA using RNeasy Micro Kits with on-column DNase I treatment to ensure high-quality samples

  • Reverse transcribe RNA into cDNA using a reliable kit such as ProtoScript Reverse Transcription Kit

  • Standardize cDNA content to approximately 75 ng/μl for consistent results

  • Design primers using tools like Primer3, with amplicon sizes between 110-200 bp

  • Validate primers through Sanger sequencing and efficiency analysis using LinRegPCR

  • Select appropriate reference genes for each brain region using tools such as RefFinder

For high-throughput analysis, pre-amplification followed by PCR on specialized chips (e.g., BioMark IPC 192×24 chips) allows for simultaneous measurement of multiple genes across numerous samples. This approach has successfully detected differential expression of transmembrane protein genes in zebrafish brains under various stress conditions .

How should researchers design stress experiments to evaluate tmem229b function in zebrafish?

When designing stress experiments to evaluate tmem229b function in zebrafish, researchers should implement a systematic approach similar to that used for other transmembrane proteins:

  • Experimental groups setup: Include multiple stress conditions alongside proper controls. Based on successful protocols, consider using:

    • Feed rewarding (positive stimulus)

    • Feed restriction (metabolic stress)

    • Air exposure (physical/hypoxic stress)

    • Control group (unstressed baseline)

  • Age and sex considerations: Separate analysis of male and female adult fish is critical as gene expression responses to stress are often sex-dependent, as demonstrated in studies of other transmembrane proteins .

  • Tissue-specific analysis: Dissect and analyze at least four key brain regions separately:

    • Telencephalon

    • Hypothalamus

    • Optic tectum

    • Rhombencephalon

  • Time course: Include multiple time points to capture both acute responses and adaptation/recovery phases. For temperature stress experiments specifically, consider including:

    • Initial exposure phase

    • Sustained stress period (12-24 hours)

    • Recovery/rewarming phase

  • Physiological markers: Monitor DNA damage using γH2AX immunostaining as a proxy for cellular stress responses .

This comprehensive approach allows for detection of region-specific, sex-specific, and stress-specific changes in tmem229b expression and function.

How can gene knockout techniques be optimized for studying tmem229b function in zebrafish?

To optimize gene knockout techniques for studying tmem229b function in zebrafish, researchers should implement CRISPR/Cas9 methodology following these critical steps:

  • gRNA design: Design guide RNAs targeting early exons of tmem229b to maximize likelihood of functional disruption. Use specialized tools like CHOPCHOP or CRISPRscan to design highly specific gRNAs with minimal off-target effects.

  • Mutation verification: After generating potential knockout lines, confirm mutations using DNA sequencing and verify that they result in frame shifts leading to truncated proteins, as demonstrated in successful studies of related transmembrane proteins .

  • Line establishment: Submit verified mutant lines to repositories like the China Zebrafish Resource Center (CZRC) to ensure standardization and reproducibility. Assign clear accession numbers to mutant lines (e.g., zko####) .

  • Phenotypic characterization: Thoroughly assess mutants for:

    • Viability and fertility

    • Embryonic development (no assumptive defects)

    • Growth parameters (standard length and body weight)

  • Functional validation: Subject knockout lines to stress challenges such as temperature stress to assess functional consequences of tmem229b loss. Include survival rate analysis under stress conditions as a key readout .

This approach has successfully revealed essential functions of related transmembrane proteins like tmem39b in stress response pathways and could be directly applied to tmem229b functional studies.

What bioinformatic approaches are most effective for analyzing tmem229b gene expression data from zebrafish?

For effective analysis of tmem229b gene expression data from zebrafish experiments, researchers should implement a multi-tiered bioinformatic approach:

  • Initial exploratory analysis: Use principal component analysis (PCA) to identify patterns in gene expression data, grouping genes according to regulatory pathways in the brain to detect coordinated responses .

  • Statistical bootstrapping: When working with limited sample sizes, bootstrap the gene expression data to build more robust random forest models for classification of responses across treatment groups .

  • Feature importance analysis: Determine which genes contribute most significantly to treatment classification using feature importance metrics from random forest models. This approach has revealed that as few as two genes (e.g., iso pre and crf-r2 in the telencephalon) can be sufficient to maintain 100% accuracy in stress response classification .

  • Brain region-specific analysis: Analyze each brain region separately, as feature importance lists differ substantially between brain regions. For instance:

Brain RegionTop Contributing Genes in Male FishContribution %Top Contributing Genes in Female FishContribution %
Telencephaloniso pre, crf-r271.22%Nine genes required66.90%
HypothalamusTop ten genes60.22%Top ten genes65.85%
Optic TectumTop ten genes62.04%Top ten genes69.48%
RhombencephalonTop ten genes64.36%Top ten genes68.92%
  • Pathway-focused analysis: Pay particular attention to HPI axis-related and serotonergic genes, which are commonly found in feature importance lists across brain regions .

This comprehensive approach allows for identification of key regulatory patterns while accounting for biological variability in zebrafish transmembrane protein expression studies.

What are the common challenges in interpreting tmem229b expression data across different brain regions in zebrafish?

Researchers face several critical challenges when interpreting tmem229b expression data across different brain regions in zebrafish:

  • Region-specific reference gene selection: Different brain regions require distinct reference genes for accurate normalization. For example, a study of transmembrane proteins found that optimal reference genes varied significantly between telencephalon, hypothalamus, optic tectum, and rhombencephalon . Researchers should evaluate 10-11 potential reference genes separately for each brain region using tools like RefFinder to avoid normalization errors.

  • Sex-dependent expression patterns: Male and female zebrafish often show dramatically different expression patterns of transmembrane proteins in response to the same stressors. For instance, in the optic tectum, iso-r2 mRNA expression in male fish was significantly lower in all stress treatments compared to controls, while female fish showed more complex regulation patterns . Always analyze male and female data separately.

  • Treatment-specific responses: Different stressors (feed rewarding, feed restriction, air exposure) can trigger distinct and sometimes contradictory expression patterns. For example, expression of dopar 2a may decrease in some stress conditions but increase in others, depending on the brain region and sex . Design experiments to include multiple stressors for comprehensive understanding.

  • Statistical power considerations: Individual fish may show high variability in expression patterns, necessitating larger sample sizes or bootstrapping approaches. Statistical techniques like random forest models can help classify responses despite individual variability .

  • Pathway integration challenges: Transmembrane protein expression must be interpreted within the context of broader regulatory networks, including stress axis, isotocin regulation, and serotonergic pathways . Analyze tmem229b within these broader functional contexts.

Addressing these challenges requires meticulous experimental design, appropriate statistical methods, and careful interpretation of results within the broader context of zebrafish physiology.

How can researchers validate antibodies for detecting native versus recombinant Danio rerio tmem229b?

Validating antibodies for detecting native versus recombinant Danio rerio tmem229b requires a systematic approach to ensure specificity and sensitivity:

  • Recombinant protein controls: Use purified recombinant tmem229b with known tag types as positive controls . Note that tag types are determined during the production process and may affect antibody binding.

  • Knockout validation: Test antibodies on tissues from tmem229b knockout zebrafish lines to confirm specificity. True tmem229b-specific antibodies should show no signal in knockout samples, similar to validation approaches used for other transmembrane proteins .

  • Western blot optimization: Perform western blots comparing:

    • Wild-type zebrafish tissue lysates

    • tmem229b-knockout tissue lysates

    • Purified recombinant tmem229b protein

  • Cross-reactivity assessment: Test for cross-reactivity with closely related transmembrane proteins by including recombinant versions of these proteins (e.g., tmem39b) in validation experiments.

  • Immunohistochemistry validation: For antibodies intended for tissue localization studies, perform immunohistochemistry on:

    • Wild-type zebrafish tissue sections

    • tmem229b-knockout tissue sections

    • Fixed cells overexpressing tagged tmem229b

  • Multiple antibody comparison: Validate results using at least two different antibodies targeting distinct epitopes of tmem229b to increase confidence in specificity.

  • Mass spectrometry confirmation: For definitive validation, perform immunoprecipitation followed by mass spectrometry to confirm that the antibody is capturing the intended protein.

This comprehensive validation approach ensures reliable detection of both native and recombinant tmem229b in experimental contexts.

What emerging technologies might enhance the study of tmem229b function in zebrafish models?

Several cutting-edge technologies show promise for advancing tmem229b research in zebrafish:

  • Single-cell RNA sequencing (scRNA-seq): This technology would enable researchers to map tmem229b expression at cellular resolution across the zebrafish brain, revealing cell type-specific expression patterns that bulk RNA analysis cannot detect. This approach could identify specialized cell populations where tmem229b plays critical roles, similar to the tissue-specific analyses already performed for other transmembrane proteins .

  • CRISPR activation/inhibition (CRISPRa/CRISPRi): These techniques allow for transient, tunable control of tmem229b expression without permanent genetic modification. This would enable temporal studies of tmem229b function during specific developmental windows or stress responses, complementing traditional knockout approaches .

  • In vivo calcium imaging: Combining tmem229b manipulation with calcium imaging in transparent zebrafish larvae could reveal real-time effects of tmem229b on neuronal activity during stress responses, providing functional insights beyond gene expression data.

  • Spatial transcriptomics: This technique maintains spatial information while assessing gene expression, allowing researchers to create comprehensive maps of tmem229b expression across intact brain tissues, revealing potential functional domains.

  • Automated behavioral phenotyping: High-throughput systems can detect subtle behavioral changes in tmem229b-mutant zebrafish, potentially revealing functional roles that might be missed by molecular analyses alone.

  • Cryo-electron microscopy: This technology could resolve the structure of tmem229b, providing insights into its functional domains and interaction partners, especially given its known amino acid sequence .

These technologies, applied systematically, would significantly advance our understanding of tmem229b's role in zebrafish physiology and stress responses.

How might tmem229b research contribute to understanding broader stress response mechanisms in vertebrates?

Research on tmem229b in zebrafish has significant potential to illuminate broader stress response mechanisms across vertebrates through several key avenues:

  • Evolutionary conservation analysis: Comparative studies of tmem229b and related transmembrane proteins across vertebrate species could reveal evolutionarily conserved stress response mechanisms. Similar approaches with tmem39b have already identified its role in cold stress responses , suggesting tmem229b might have equally conserved functions.

  • Integrated stress pathway mapping: Comprehensive analysis of tmem229b's interactions with established stress response networks—including the HPI axis, serotonergic, and isotocin regulation pathways—could reveal novel regulatory connections relevant across vertebrates . The feature importance analyses already conducted for other transmembrane proteins provide a methodological framework for such investigations.

  • DNA damage response mechanisms: Given that related transmembrane proteins like tmem39b protect against DNA damage during stress responses , investigating whether tmem229b plays similar roles could reveal fundamental mechanisms of cellular protection conserved from fish to mammals.

  • Sex-specific stress responses: The pronounced sex differences observed in transmembrane protein expression during stress responses in zebrafish may provide insights into sex-specific stress vulnerabilities across vertebrates, an increasingly important area in stress research.

  • Brain region specialization: The region-specific expression patterns of transmembrane proteins in zebrafish brains under stress may reflect fundamental principles of brain organization and stress circuit evolution across vertebrates.

By leveraging the experimental accessibility of zebrafish while focusing on mechanistic understanding, tmem229b research has significant translational potential for broader vertebrate stress biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.