Recombinant Danio rerio Transmembrane protein 231 (tmem231)

Shipped with Ice Packs
In Stock

Description

General Information

Danio rerio Transmembrane protein 231, or Tmem231, is a protein that, in humans, is encoded by the TMEM231 gene . It is a component of the MKS complex, which is essential for the organization of the transition zone (TZ) and the maintenance of ciliary protein composition .

Table 1: General Information of Recombinant Danio rerio Tmem231

CategoryDescription
SpeciesZebrafish
SourceE. coli
TagHis
Protein LengthFull Length (1-309 amino acids)
FormLyophilized powder
Synonymstmem231; zgc:64166; Transmembrane protein 231
UniProt IDQ7T316
Amino Acid SequenceMAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLVAYRSQGFWLKRNSYEEQPVVKFQYDLILLGVTDTTGNYLAWSTFPNFNRLIGDNLRIPEISAQEEDKNQDGKSDVLLLQISVPLKPAEQMFSVQLLLTFSYQLFRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQRTPLPHRGLHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANAPFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTITIPPFKQHRS

Function and Significance

Tmem231 plays a crucial role in localizing MKS complex components to the TZ of cilia and maintaining ciliary protein composition . Cilia are cellular structures involved in various signaling pathways and developmental processes. The TZ acts as a gatekeeper, regulating the entry and exit of proteins into and out of cilia. Tmem231 interacts with multiple components of the MKS complex, including B9d1, Mks1, Tctn1, Tctn2, Tctn3, Cc2d2a (Mks6), and Tmem17 .

Role in Ciliopathies

Mutations in TMEM231 are associated with MKS and OFD3, both of which are ciliopathies . These syndromes are characterized by a range of developmental abnormalities, including kidney cysts, polydactyly (extra fingers or toes), and hepatic ductal plate malformations . Studies on mouse models with Tmem231 mutations have shown similar phenotypes, further confirming the protein's role in these disorders .

Research Findings

  • Tmem231 and MKS Complex Organization: Research indicates that Tmem231 is essential for the correct localization of B9d1, a key component of the MKS complex, to the TZ. Mutations in Tmem231 disrupt the formation of the MKS complex at the TZ, leading to defective ciliary membrane composition and ciliary signaling .

  • Tmem231 Mutant Phenotypes: Mouse embryos with loss-of-function Tmem231 mutations exhibit MKS-like phenotypes, such as polycystic kidneys, polydactyly, and hepatic ductal plate malformations .

  • Interaction with B9d1: Tmem231 has been identified as an interaction partner of B9d1, and disease-associated mutations in Tmem231 can compromise the protein's levels, affecting its function . Co-immunoprecipitation assays have validated the interactions between Tmem231, B9d1, and Mks1 .

  • Splice Variants: Novel splice variants of the TMEM231 gene have been identified, expanding the understanding of its genetic complexity .

Table 2: Effects of Disease-Associated Tmem231 Mutations

MutationEffect
p.Asn90IleCompromises Tmem231 protein levels; mislocalizes B9d1 away from the TZ.
p.Pro125AlaCompromises Tmem231 protein levels.
OtherDisrupts formation of the MKS complex at the TZ.

Methods of Study

The study of Tmem231 involves various molecular and cellular biology techniques:

  • Co-immunoprecipitation: Used to validate the interaction between Tmem231 and other MKS complex components .

  • Quantitative real-time PCR (qPCR): Used to quantify the mRNA expression of TMEM231 in different tissues .

  • Mass Spectrometry: Used to identify interacting partners of Tmem231 .

  • Cellular Localization Studies: Employing fluorescently tagged proteins to observe the localization of Tmem231 and its interacting partners within cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tmem231; zgc:64166; Transmembrane protein 231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem231
Target Protein Sequence
MAFYDVYAHPALIRYRTCVCTRATLFVCVVLGLTYISPLLVAYRSQGFWLKRNSYEEQPV VKFQYDLILLGVTDTTGNYLAWSTFPNFNRLIGDNLRIPEISAQEEDKNQDGKSDVLLLQ ISVPLKPAEQMFSVQLLLTFSYQLFRMSTVVMQTLAFIQHSSPVPGSQLFICGDLRLNQR TPLPHRGLHSTYNVSVIDGSSPFASTYDLTNIIRLYQQRNLTTHLSGVIPVWTVGRAANA PFQISAQIHYPVEMIDYRPGFWETIKFAWIQYVSVLLIFLWVFQHIQTFIFQNQVLPTIT IPPFKQHRS
Uniprot No.

Target Background

Function

Function: Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia. This complex acts as a barrier, preventing transmembrane protein diffusion between cilia and the plasma membrane. tmem231 is essential for ciliogenesis and sonic hedgehog (SHH) signaling.

Database Links
Protein Families
TMEM231 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is the primary function of tmem231 in Danio rerio?

Tmem231 in Danio rerio functions as a transmembrane component of the tectonic-like complex, which is localized at the transition zone of primary cilia. This complex acts as a critical barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. The protein is required for both ciliogenesis and proper sonic hedgehog (SHH) signaling pathways . Studies in mammalian models have demonstrated that Tmem231 disruption leads to disrupted localization of proteins including Arl13b and Inpp5e to cilia, resulting in phenotypes characteristic of Meckel syndrome such as polydactyly and kidney cysts . This suggests a highly conserved functional role across vertebrate species.

Which protein partners interact with tmem231 in the ciliary transition zone?

Tmem231 interacts with multiple proteins to form a functional transition zone complex. The most significant protein interactions include:

Protein PartnerInteraction ScoreFunction
b9d10.998Component of tectonic-like complex; required for ciliogenesis and SHH signaling
b9d20.994Component of tectonic-like complex
tctn10.994Tectonic family member
tmem170.986Transmembrane component of tectonic-like complex
TMEM2160.984Required for tissue-specific ciliogenesis
tmem670.983Transmembrane protein in TZ complex
nphp10.967Nephronophthisis-associated protein
cc2d2a0.961Coiled-coil and C2 domain-containing protein
nphp40.941Nephronophthisis-associated protein
rpgrip1l0.940RPGRIP1-like protein

These interactions form the basis of the MKS complex, with B9d1 and Tmem231 being reciprocally required for their localization to the transition zone .

How does tmem231 contribute to the assembly of the MKS complex at the transition zone?

Tmem231 plays a crucial role in the hierarchical assembly of the MKS complex at the transition zone. Research has demonstrated that Tmem231 and B9d1 are reciprocally required for their localization to the transition zone. When either Tmem231 or B9d1 is absent, the other fails to localize properly to the transition zone . This interdependence extends to other MKS complex components, as both Tmem231 and B9d1 are necessary for the proper localization of Mks1 and Tmem67 (Mks3) to the transition zone.

In contrast, the localization of other transition zone proteins such as Rpgrip1l is not affected by the absence of Tmem231 or B9d1. Interestingly, the loss of either Tmem231 or B9d1 results in increased accumulation of Nphp1 at the transition zone, suggesting a complex regulatory relationship between different transition zone modules . These findings indicate that Tmem231 functions as a central assembly factor for the MKS complex, establishing a foundation for the proper organization of the ciliary transition zone.

What are the evolutionary implications of tmem231 conservation across species?

The evolutionary conservation of tmem231 across species has significant implications for understanding ciliary biology and disease mechanisms. Studies comparing Tmem231 function in C. elegans, zebrafish, and mammals reveal a remarkably conserved role in transition zone formation and function . This conservation suggests that Tmem231 emerged early in the evolution of ciliated organisms and has maintained its critical function in regulating ciliary composition.

In C. elegans, TMEM-231 localizes to the transition zone and cooperates with other MKS complex proteins to build the transition zone and prevent non-ciliary proteins like TRAM-1a from entering the cilium . The conservation of this gatekeeping function across evolutionary distant species highlights the fundamental importance of transition zone regulation in ciliary function. This evolutionary perspective provides valuable insights for researchers using different model organisms to study ciliary biology, as findings in one species may have direct relevance to others, including humans.

How do mutations in tmem231 affect ciliary function and signaling pathways?

Mutations in tmem231 have profound effects on ciliary function and downstream signaling pathways. In knockout models, the absence of functional Tmem231 disrupts the ciliary localization of specific membrane proteins, including Arl13b and Inpp5e . This mislocalization indicates a compromised diffusion barrier at the transition zone, allowing inappropriate movement of proteins between ciliary and plasma membrane compartments.

The disruption of ciliary protein composition has cascading effects on ciliary signaling, particularly the Sonic Hedgehog (SHH) pathway. The SHH pathway, which depends on proper ciliary function, influences various developmental processes. When tmem231 is mutated, SHH signaling becomes dysregulated, contributing to developmental abnormalities such as polydactyly (extra digits) and neural tube defects . Additionally, defective tmem231 function leads to disruptions in left-right patterning and kidney development, reflecting the diverse roles of cilia in organogenesis and tissue patterning.

What approaches are effective for studying tmem231 localization in zebrafish cilia?

Investigating tmem231 localization in zebrafish cilia requires specialized imaging and molecular techniques. A multi-modal approach is recommended:

  • Fluorescent protein tagging: Generating transgenic zebrafish expressing GFP- or other fluorescent protein-tagged tmem231 allows for live imaging of protein localization. This approach can be implemented by inserting the fluorescent tag at either the N- or C-terminus of the protein, though care must be taken to ensure the tag doesn't interfere with protein function .

  • Immunofluorescence microscopy: Using specific antibodies against tmem231 and co-staining with established transition zone markers (such as Cc2d2a or B9d1) provides high-resolution images of protein localization. This technique is particularly useful for fixed samples and can be combined with super-resolution microscopy for nanoscale localization .

  • Transmission electron microscopy (TEM): For ultrastructural analysis of the transition zone, TEM provides detailed images of ciliary substructures. This can be combined with immunogold labeling to precisely locate tmem231 within the transition zone architecture.

  • Expansion microscopy: This newer technique physically expands the sample to achieve super-resolution imaging on standard microscopes, offering an alternative approach for visualizing the detailed organization of the transition zone complex.

These approaches can be complemented with genetic manipulations using CRISPR/Cas9 or morpholinos to assess localization in the absence of interacting partners .

How can protein-protein interactions of tmem231 be effectively characterized?

Characterizing the protein-protein interactions of tmem231 requires multiple complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): This technique involves tagging tmem231 with a localization and affinity purification (LAP) tag, purifying the protein along with its interaction partners, and identifying these partners through mass spectrometry. This approach has successfully identified multiple MKS complex components that interact with Tmem231 .

  • Co-immunoprecipitation (Co-IP): Validating interactions through Co-IP provides evidence for physical associations between tmem231 and its partners. This can be performed with epitope-tagged versions of tmem231 and suspected interaction partners, as demonstrated in studies that confirmed interactions between Tmem231, B9d1, and Mks1 .

  • Yeast two-hybrid (Y2H) assays: These provide an additional system for testing direct protein-protein interactions and can help map interaction domains within the proteins.

  • Proximity labeling techniques: BioID or APEX2-based approaches, where a proximity-dependent biotin ligase is fused to tmem231, allow for identification of proteins that are in close proximity in living cells.

  • Fluorescence resonance energy transfer (FRET): For visualizing interactions in living cells, FRET between fluorescently tagged proteins can provide spatial and temporal information about interactions.

These methodologies should be applied in appropriate cellular contexts, such as ciliated zebrafish cells or tissues, to ensure physiological relevance of the identified interactions .

What are the optimal approaches for generating recombinant Danio rerio tmem231 for functional studies?

Generating recombinant Danio rerio tmem231 requires careful consideration of expression systems and protein characteristics:

  • Expression vector selection: For bacterial expression, the pET system in E. coli BL21(DE3) can be used for cytoplasmic domains, while membrane protein expression systems like C43(DE3) may be more appropriate for full-length protein. Eukaryotic expression systems (insect cells or mammalian cells) are often preferred for proper folding and post-translational modifications.

  • Fusion tags: Addition of solubility-enhancing tags (MBP, SUMO) can improve yield and solubility. For purification, His6, FLAG, or GST tags are commonly used. Consider designing constructs with removable tags via protease cleavage sites.

  • Domain-based approach: Given that tmem231 is a transmembrane protein, expressing soluble domains separately may facilitate structural and functional studies. Based on the predicted topology, N-terminal and C-terminal domains can be expressed as soluble fragments.

  • Membrane mimetics: For full-length protein studies, reconstitution into nanodiscs, liposomes, or detergent micelles is essential to maintain native structure and function.

  • Mutagenesis strategy: Site-directed mutagenesis can be used to generate disease-associated variants (like the p.R7W mutation) or to test structure-function relationships. Designing mutations at conserved residues or at predicted interaction interfaces can provide insights into functional domains .

Validation of properly folded recombinant protein should include circular dichroism spectroscopy for secondary structure analysis and functional binding assays with known interaction partners such as B9d1 .

How can CRISPR/Cas9 be optimized for generating tmem231 knockout in zebrafish models?

Optimizing CRISPR/Cas9 for generating tmem231 knockout in zebrafish requires careful planning:

  • gRNA design: Target early exons (preferably exon 1) of tmem231 to ensure complete loss of function. Use multiple prediction algorithms to identify gRNAs with high on-target and low off-target scores. Based on the conservation data, targeting the region encoding the R7 residue, which is conserved in primates, could be effective .

  • Delivery method: Microinjection of Cas9 protein (rather than mRNA) combined with chemically modified gRNAs into one-cell stage embryos typically yields higher editing efficiency.

  • Mutation verification: Design PCR primers flanking the target site for initial screening, followed by sequencing to confirm mutations. For high-throughput screening, heteroduplex mobility assays or T7 endonuclease assays can be used.

  • Phenotypic validation: Based on the literature, examine embryos for ciliopathy-related phenotypes such as curved body axis, otolith defects, pronephric cysts, and left-right patterning abnormalities. The phenotypes should resemble those seen in other zebrafish models of ciliopathies .

  • Off-target analysis: Perform whole genome sequencing of selected mutant lines to rule out significant off-target mutations, focusing particularly on predicted off-target sites.

  • Rescue experiments: Design rescue constructs expressing wild-type tmem231 to confirm the specificity of observed phenotypes. Including disease-associated mutations (like p.R7W) in rescue constructs can provide insights into pathogenic mechanisms .

When establishing stable lines, consider generating compound heterozygotes with different mutations to avoid potential background-specific effects .

How should researchers interpret discrepancies in phenotypic outcomes between different tmem231 mutation models?

When faced with phenotypic discrepancies between different tmem231 mutation models, researchers should consider several factors:

  • Mutation type variation: Different mutations (missense vs. null) can produce varying phenotypic severities. Complete knockouts may cause more severe phenotypes than hypomorphic mutations. For example, the human p.R7W mutation identified in a Chinese fetus may have different effects than a complete gene deletion .

  • Genetic background effects: The genetic background of the zebrafish strain can significantly influence phenotype penetrance and expressivity. Consider testing mutations in multiple genetic backgrounds or using outcrossing strategies to identify background-specific modifiers.

  • Maternal contribution: Maternally deposited tmem231 mRNA or protein may mask early developmental phenotypes in zygotic mutants. Generating maternal-zygotic mutants may reveal earlier developmental roles.

  • Functional redundancy: Related proteins, particularly other MKS complex components, may partially compensate for tmem231 loss. Consider generating double mutants with interacting partners like b9d1 to uncover masked phenotypes .

  • Environmental factors: Rearing conditions (temperature, water quality, feeding) can influence phenotype manifestation, particularly for subtle phenotypes.

  • Quantitative phenotyping approaches: Employ quantitative measures rather than binary (affected/unaffected) classifications. For example, measure ciliary length, transition zone ultrastructure dimensions, or protein localization intensity across multiple samples for statistical comparison .

When reporting discrepancies, researchers should thoroughly document genetic backgrounds, environmental conditions, and quantitative phenotypic measures to facilitate reproducibility and accurate interpretation .

What considerations are important when analyzing protein localization data for tmem231 and its interaction partners?

When analyzing protein localization data for tmem231 and its interaction partners, several critical considerations should guide interpretation:

  • Resolution limitations: Standard confocal microscopy has limited resolution (~200 nm) that may be insufficient to distinguish subdomains within the transition zone. Super-resolution techniques (STED, PALM, STORM) provide more precise localization data but have their own technical limitations.

  • Antibody specificity: Validate antibody specificity using appropriate controls, including tmem231 mutant tissues and western blotting, to ensure signals represent true protein localization.

  • Fixation artifacts: Different fixation methods can alter protein localization. Compare multiple fixation protocols and consider combining with live imaging of fluorescently tagged proteins.

  • Developmental timing: The transition zone assembles progressively during ciliogenesis. Consider temporal dynamics by examining multiple developmental stages and time points.

  • Tissue-specific variations: Ciliary composition varies between tissues. Compare tmem231 localization across multiple ciliated tissues (e.g., pronephros, neural tube, sensory organs) to identify tissue-specific patterns.

  • Quantitative analysis: Employ quantitative approaches such as intensity profile analysis along the ciliary axis or colocalization coefficients (Pearson's or Mander's) when comparing localization patterns of multiple proteins.

  • Hierarchical dependency: When interpreting localization in mutant backgrounds, consider that the absence of one protein may affect localization of others in complex ways. For example, in Tmem231-/- MEFs, B9d1 fails to localize to the transition zone, while in B9d1-/- MEFs, Tmem231 no longer concentrates at the transition zone, indicating reciprocal dependency .

These considerations help distinguish between direct and indirect effects on protein localization, providing clearer insights into the molecular organization of the transition zone .

What are promising approaches for investigating the role of tmem231 in ciliopathy disease mechanisms?

Future research into tmem231's role in ciliopathy disease mechanisms should consider these promising approaches:

  • Patient-derived models: Generating induced pluripotent stem cells (iPSCs) from patients with TMEM231 mutations and differentiating them into relevant cell types (renal cells, neural organoids) provides a platform for studying disease mechanisms in human contexts. These can be complemented with isogenic corrected controls using CRISPR-based approaches.

  • Zebrafish humanization: Creating zebrafish models expressing human TMEM231 variants (like the p.R7W mutation) in a tmem231-null background allows for functional assessment of human mutations in an in vivo context .

  • Ciliary proteomics: Comparative proteomic analysis of ciliary fractions from wild-type versus tmem231 mutant zebrafish can identify changes in ciliary protein composition, providing insights into disease mechanisms.

  • Live imaging of ciliary trafficking: Developing zebrafish lines with fluorescently tagged ciliary proteins combined with high-speed confocal microscopy would allow visualization of dynamic protein movements into and out of cilia in the presence and absence of functional tmem231.

  • Tissue-specific requirements: Using conditional knockout strategies or tissue-specific rescue approaches to determine whether tmem231 functions differently across tissues, which may explain the variable organ involvement in ciliopathies.

  • Pharmacological screens: Developing assays based on ciliary protein mislocalization in tmem231 mutants could enable screening for compounds that rescue proper protein localization, potentially identifying therapeutic avenues for ciliopathies .

These approaches together would provide a comprehensive understanding of how tmem231 dysfunction leads to ciliopathies and potentially identify therapeutic targets for these currently incurable disorders.

How might interactions between tmem231 and the sonic hedgehog pathway be further elucidated?

The interaction between tmem231 and the sonic hedgehog (SHH) pathway represents a critical area for further research, as disruption of this relationship underlies many ciliopathy phenotypes. Promising approaches include:

  • Quantitative pathway analysis: Developing zebrafish reporter lines that quantitatively measure SHH pathway activity (e.g., using GFP under ptch1 or gli1 promoters) in wild-type versus tmem231 mutant backgrounds would allow for precise measurement of pathway disruption.

  • Tissue-specific effects: Examining SHH pathway activity across multiple tissues in tmem231 mutants, with particular focus on those relevant to ciliopathy phenotypes (neural tube, limb buds, kidneys, liver) would identify tissue-specific requirements.

  • Epistasis experiments: Generating double mutants between tmem231 and various SHH pathway components would establish the position of tmem231 relative to the canonical pathway. Similarly, testing whether constitutively active SHH pathway components can rescue tmem231 mutant phenotypes would clarify the relationship.

  • Ciliary localization of SHH components: High-resolution imaging of SHH pathway component localization (Smoothened, Gli proteins, Sufu) in the presence and absence of tmem231 would reveal how transition zone disruption affects their trafficking and distribution.

  • Temporal dynamics: Using temporally controlled expression systems to determine critical periods when tmem231 function is required for SHH signaling during development.

  • Biochemical interactions: Investigating whether tmem231 or its complex members directly interact with SHH pathway components using proximity labeling or co-immunoprecipitation approaches .

These approaches would not only deepen our understanding of the mechanisms underlying ciliopathy phenotypes but may also reveal novel insights into fundamental aspects of ciliary signaling regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.