Recombinant Danio rerio Transmembrane protein 237A (tmem237a)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Properties

Recombinant Danio rerio Transmembrane Protein 237A (tmem237a) is a His-tagged, full-length recombinant protein derived from zebrafish. It is expressed in E. coli and retains its native structure for research applications. Key properties include:

PropertyValue
Gene Nametmem237a (synonyms: als2cr4a, si:dkey-33m14.6)
Protein LengthFull-length (1-377 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
UniProt IDF1Q930

Note: The recombinant protein is not for human consumption .

Ciliary Transition Zone (TZ) Function

  • Primary Role: Component of the ciliary TZ, essential for ciliogenesis and basal body anchoring .

  • Interactions: Forms functional networks with TZ proteins such as NPHP4, MKS2, MKSR1/B9D1, and MKS5/RPGRIP1L .

  • Zebrafish Studies: Knockdown of tmem237a disrupts gastrulation and ciliary structure, mirroring human ciliopathies .

Intestinal Riboflavin Transport

  • Interaction with RFVT-3: Binds to the riboflavin transporter-3 (RFVT-3) in intestinal epithelial cells, enhancing riboflavin uptake and protein stability .

  • Regulation: Expression modulated by TNF-α (downregulation) and butyrate (upregulation) .

Retinal Localization

  • Mouse Retina: Localizes to photoreceptor outer segments and interacts with cytoskeletal proteins (e.g., actin, myosin) .

Key Experimental Insights

Study FocusFindingsSource
Ciliogenesistmem237a knockdown in zebrafish causes gastrulation defects; rescues with human TMEM237 .
RFVT-3 InteractionCo-immunoprecipitation confirms binding; TMEM237 enhances RF uptake by 2-fold.
Retinal FunctionCo-localizes with outer segment discs; interacts with myosin and kinesin.
Ciliopathy LinksHuman TMEM237 mutations cause Joubert syndrome (JSRD14) .

Joubert Syndrome (JSRD14)

  • Genetic Basis: Mutations in TMEM237 disrupt TZ integrity, leading to cerebellar, renal, and retinal abnormalities .

  • Variant Database: 78 public variants reported in LOVD, with 41 unique DNA variants .

Research Applications

ApplicationDetails
Ciliogenesis StudiesUsed to model ciliary dysfunction in zebrafish and C. elegans .
Intestinal TransportInvestigates riboflavin absorption mechanisms .
Protein InteractionCo-IP and yeast two-hybrid assays to study binding partners .

Table 1: Interacting Proteins

PartnerInteraction MethodBiological Context
RFVT-3Co-IP, Yeast Two-HybridIntestinal riboflavin transport
NPHP4Genetic interactionCiliary TZ structure
Myosin (Va, VI, X, XIV)ImmunoprecipitationRetinal transport

Table 2: Pathway Involvement

PathwayRole
CiliogenesisTZ formation and membrane anchoring .
Wnt SignalingRegulates signaling in ciliopathies .
Riboflavin MetabolismStabilizes RFVT-3 and enhances uptake .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
tmem237a; als2cr4a; Transmembrane protein 237A; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem237a
Target Protein Sequence
MCVTSRADKMPSVKPKKKKIKKEINEVEEPEAGPEPAIEMEGLESRRQSESREPLTPEPH DNPPLKKKKKKKTHTFENEGEQQDHPNGDVQESPTDGEEVTKKSKKKRKNKMMENQSHNE LGVEEDDIITDVHAPISQRSLFSAPLSHSHPIGKVFVEKNRRFQATDLSHDHLEEYMEVR PMWNTRDVAMRVHSGFRIIGLFSHGFLAGYAVWNIIVVYVLAGEQMTTLPNLLQQYHSLA YPAQSLLYLLLAISTVSAFDRVNLAKASMALRGFLTLDPAALASFLYFAALILSLSQQMT SDRIHLYPTANETLWPPGLEHQILQPWIVVNLVVALLVGLAWVFVATRPDMDYTEEFLMA MEVEEYPRHDDKHELAA
Uniprot No.

Target Background

Function
Transmembrane protein 237A (TMEM237A) is a component of the transition zone in primary cilia. It is essential for ciliogenesis.
Database Links
Protein Families
TMEM237 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is Transmembrane Protein 237A (tmem237a) in zebrafish?

Transmembrane Protein 237A (tmem237a) is one of two paralogs of TMEM237 found in zebrafish (Danio rerio), with tmem237b being the other paralog. It functions as a component of the transition zone in primary cilia and plays an essential role in ciliogenesis. The protein consists of 377 amino acids and serves as a critical structural element that helps maintain ciliary function . TMEM237 was previously known as ALS2CR4 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein), and both zebrafish paralogs share over 50% protein sequence identity with their human ortholog .

What is the function of tmem237a in ciliary biology?

Tmem237a functions as a component of the ciliary transition zone, a specialized compartment that acts as a selective barrier between the cilium and the cell body. This transition zone is crucial for controlling the entry and exit of proteins into the ciliary compartment, thereby maintaining ciliary composition and function. The protein is required for proper ciliogenesis, the process by which cells form primary cilia . The transition zone where tmem237a operates serves as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes, ensuring proper compartmentalization necessary for ciliary signaling functions .

How does tmem237a compare to human TMEM237?

Zebrafish tmem237a shares over 50% protein sequence identity with human TMEM237, indicating significant evolutionary conservation of this protein . In humans, mutations in TMEM237 are associated with Joubert Syndrome, a ciliopathy characterized by brain malformation, intellectual disability, retinal dystrophy, and renal disease. Both the human and zebrafish proteins localize to the ciliary transition zone and play crucial roles in ciliogenesis, suggesting functional conservation across species . This high degree of conservation makes zebrafish an excellent model organism for studying the molecular mechanisms of TMEM237-related human diseases.

What protein interactions are important for tmem237a function?

Tmem237a participates in a complex network of protein interactions within the ciliary transition zone. According to protein interaction data, tmem237a has several predicted functional partners with varying interaction scores :

ProteinDescriptionInteraction Score
arr3bArrestin 3b, retinal (X-arrestin)0.709
kcnv2bPotassium channel, subfamily V, member 2b0.641
rom1bRetinal outer segment membrane protein 1b0.569
tmem231Transmembrane protein 2310.557
mapk10Mitogen-activated protein kinase0.545
arr3aArrestin 3, retinal (X-arrestin), like0.541
kcnv2aPotassium channel, subfamily V, member 2a0.540
nphp1Nephronophthisis 10.531
polr2fPolymerase (RNA) II (DNA directed) polypeptide F0.523
zgc:174895Zgc:1748950.504

Of particular significance is the interaction with tmem231, another transmembrane component of the tectonic-like complex at the transition zone, which is also required for ciliogenesis and sonic hedgehog signaling . The high interaction score with arr3b (Arrestin 3b) suggests important functional relationships with retinal proteins, potentially relevant to the retinal phenotypes observed in ciliopathies.

What experimental approaches are most effective for studying tmem237a function?

Morpholino oligonucleotides (MOs) have been successfully employed to knockdown tmem237a expression in zebrafish. The specific MO sequence used for tmem237a is 5′-TTGTCTGTGTGAAAGGCAGAAATCA-3′ . These MOs are typically microinjected into one-to-two cell stage embryos at concentrations of 1-2 ng depending on whether the experiment is focused on rescue or interaction studies . This approach enables transient knockdown of tmem237a during early development, allowing researchers to observe resulting phenotypes.

Additionally, rescue experiments using human TMEM237 cDNA have been conducted to demonstrate specificity of the observed phenotypes and confirm functional conservation between species. Full-length cDNA of human TMEM237 can be obtained by RT-PCR amplification from human RNA sources and subcloned into appropriate expression vectors such as pCS2+ . This combined knockdown-rescue approach provides robust evidence for gene function and conservation.

How does tmem237a dysfunction affect Wnt signaling pathways?

Loss of mammalian TMEM237 results in defective ciliogenesis and deregulation of Wnt signaling pathways . While the specific mechanisms in zebrafish are not fully elucidated, this finding suggests that tmem237a plays an important role in regulating Wnt signaling, which is critical for numerous developmental processes including cell proliferation, migration, and cell fate determination. Primary cilia serve as important signaling centers for developmental pathways, and disruption of ciliary structure or function through tmem237a loss appears to impact Wnt signal transduction.

The connection between ciliary dysfunction and aberrant Wnt signaling provides an important mechanistic link that may explain how tmem237a mutations lead to the developmental abnormalities observed in ciliopathies. This relationship highlights the importance of proper ciliary compartmentalization, which is maintained in part by transition zone proteins like tmem237a, for normal cellular signaling and development.

What are the consequences of tmem237a knockdown in zebrafish models?

Disruption of tmem237 expression in zebrafish produces gastrulation defects consistent with ciliary dysfunction . These developmental abnormalities likely reflect the essential role of tmem237a in ciliogenesis and ciliary function. While the search results don't provide exhaustive details on the specific phenotypes, ciliary defects in zebrafish typically manifest as curved body axis, hydrocephalus, kidney cysts, and left-right asymmetry defects.

The zebrafish Caenorhabditis elegans jbts-14 (the ortholog of TMEM237) genetically interacts with nphp-4, encoding another transition zone protein, to control basal body-transition zone anchoring to the membrane and ciliogenesis . This genetic interaction suggests that tmem237a functions in concert with other transition zone proteins to maintain ciliary integrity, and disruption of this network leads to compromised ciliary structure and function.

How should researchers design morpholino knockdown experiments for tmem237a?

When designing morpholino knockdown experiments for tmem237a, researchers should consider several critical factors to ensure reliable and interpretable results:

First, morpholino selection and dosage are crucial. The validated morpholino sequence for tmem237a is 5′-TTGTCTGTGTGAAAGGCAGAAATCA-3′ . Typically, 1-2 ng of morpholino is microinjected into one-to-two cell stage embryos, with 1 ng recommended for interaction studies and 2 ng for rescue experiments . Careful titration of morpholino concentration is essential to achieve sufficient knockdown while minimizing off-target effects.

Second, appropriate controls must be included. These should encompass standard control morpholinos, uninjected embryos, and rescue controls using human TMEM237 cDNA to confirm phenotype specificity . Validation of knockdown efficiency at the protein or mRNA level provides important quality control.

Third, phenotypic analysis should evaluate multiple aspects of ciliary function, including body axis formation, organ development (particularly kidneys and brain), and left-right asymmetry. Molecular markers for ciliary structure and function can provide more detailed assessment of the knockdown effects.

What approaches can distinguish between tmem237a and tmem237b functions?

Distinguishing the functions of the two zebrafish paralogs, tmem237a and tmem237b, requires targeted experimental approaches:

Paralog-specific knockdown is essential, using distinct morpholinos for each gene. The morpholino sequence for tmem237a is 5′-TTGTCTGTGTGAAAGGCAGAAATCA-3′, while for tmem237b it is 5′-TGGAAACCTACACTTAACAATATGT-3′ . This specificity allows researchers to assess the independent contribution of each paralog to development and ciliary function.

Comparative phenotypic analysis following knockdown of each paralog can reveal functional distinctions or redundancies. Differences in severity, timing, or tissue specificity of phenotypes may indicate distinct functions for each paralog.

Rescue experiments can further illuminate functional relationships between the paralogs. Testing whether overexpression of one paralog can rescue knockdown of the other provides insight into their functional equivalence or specialization. Similarly, testing whether human TMEM237 can rescue either or both paralogs informs our understanding of evolutionary conservation and divergence.

What considerations are important for expressing recombinant tmem237a protein?

While specific conditions for recombinant tmem237a expression aren't detailed in the search results, information about the related tmem237b protein provides valuable guidance. For transmembrane proteins like tmem237a, expression and purification present particular challenges due to their hydrophobic domains.

Based on protocols for tmem237b, an in vitro E.coli expression system with an N-terminal 10xHis-tag appears effective . This approach facilitates purification via metal affinity chromatography. For proper storage, the recombinant protein should be kept at -20°C for regular use, or at -20°C/-80°C for extended storage .

Critical considerations include avoiding repeated freeze-thaw cycles, which can compromise protein integrity, and limiting storage of working aliquots to 4°C for no more than one week . The shelf life of liquid preparations is typically around 6 months at -20°C/-80°C, while lyophilized forms may remain stable for approximately 12 months .

Given the transmembrane nature of the protein, detergent selection during purification and storage will significantly impact solubility and native conformation preservation. Optimization of these conditions is crucial for obtaining functional recombinant tmem237a.

How can researchers address variable penetrance in tmem237a knockdown phenotypes?

Variable penetrance in tmem237a knockdown phenotypes poses a significant challenge for researchers. This variability may arise from several factors that require systematic investigation and mitigation strategies.

Morpholino efficiency can vary between injections and between embryos within the same injection batch. Quantifying the level of knockdown through qPCR or protein expression analysis allows researchers to correlate phenotypic severity with knockdown efficiency. This approach can help distinguish technical variability from biological phenomena.

Genetic compensation, particularly by the paralog tmem237b, may contribute to phenotypic variability. Dual knockdown experiments targeting both paralogs simultaneously can reveal potential compensatory mechanisms. Additionally, examining tmem237b expression levels in tmem237a morphants may identify upregulation indicative of compensation.

Maternal contribution of tmem237a mRNA or protein can buffer early developmental defects, resulting in delayed or less severe phenotypes. Careful staging of embryos and temporal analysis of phenotype development can help identify this effect. In some cases, generating maternal-zygotic mutants may be necessary to completely eliminate gene function.

Strain-specific genetic modifiers can significantly influence phenotypic outcomes. Using multiple zebrafish strains or creating hybrids between strains can help identify genetic background effects on phenotype penetrance and expressivity.

What strategies can resolve conflicting data on tmem237a function?

When confronted with conflicting data regarding tmem237a function, researchers should employ multiple complementary approaches to resolve discrepancies:

First, compare knockdown methodologies, as different approaches (morpholinos, CRISPR/Cas9, dominant negatives) may produce varying results due to their inherent limitations. Validating findings using multiple independent methods provides stronger evidence for gene function.

Second, assess genetic interactions with known ciliary genes like nphp1, tmem231, or components of the Wnt pathway. Genetic interaction studies can provide context for seemingly contradictory results by revealing functional redundancies or pathway compensations.

Third, conduct detailed phenotypic analyses across multiple developmental stages and tissues. Different assays may detect distinct aspects of ciliary dysfunction, and the temporal progression of phenotypes can provide crucial mechanistic insights.

Fourth, perform rescue experiments with both zebrafish tmem237a and human TMEM237 to confirm specificity and conservation. Differential rescue efficiencies may help explain varied phenotypic observations.

Finally, consider tissue-specific or conditional approaches to gene manipulation, as global knockdown may obscure tissue-specific functions or trigger compensatory mechanisms that complicate interpretation.

How should researchers interpret protein interaction data for tmem237a?

Interpreting protein interaction data for tmem237a requires careful consideration of both the strengths and limitations of the available information:

Functional clustering of interaction partners can reveal biological pathways and processes in which tmem237a participates. The presence of multiple retinal proteins (arr3b, arr3a, rom1b) suggests important functions in photoreceptor cells, while interaction with tmem231 and nphp1 confirms its role in the ciliary transition zone complex .

Researchers should consider the cellular context of these interactions, as protein interactions may be tissue-specific or developmentally regulated. The biological significance of an interaction depends not only on its strength but also on the spatiotemporal context in which it occurs.

Cross-species conservation of interactions provides additional confidence in their biological relevance. Interactions conserved between zebrafish tmem237a and human TMEM237 are more likely to represent fundamental aspects of protein function rather than species-specific adaptations.

How does tmem237a research inform our understanding of Joubert Syndrome?

Research on zebrafish tmem237a provides valuable insights into the molecular mechanisms underlying Joubert Syndrome, a ciliopathy associated with mutations in human TMEM237 . The high degree of protein sequence identity (>50%) between zebrafish tmem237a and human TMEM237 makes zebrafish an excellent model for studying disease mechanisms .

Studies in zebrafish demonstrate that loss of tmem237a function leads to developmental defects consistent with ciliary dysfunction . These phenotypes parallel aspects of Joubert Syndrome, which is characterized by brain malformation, intellectual disability, retinal dystrophy, and renal disease. The zebrafish model allows researchers to observe these developmental processes in real-time in a vertebrate system.

Mechanistically, tmem237a research has revealed the protein's localization to the ciliary transition zone and its requirement for ciliogenesis . This localization is conserved with human TMEM237, indicating that disruption of transition zone function is a key pathogenic mechanism in Joubert Syndrome. Additionally, the deregulation of Wnt signaling observed with loss of TMEM237 provides a potential link between ciliary dysfunction and the developmental abnormalities characteristic of the syndrome .

What zebrafish models can advance therapeutic development for ciliopathies?

Zebrafish models of tmem237a dysfunction offer several advantages for therapeutic development for ciliopathies:

Morpholino-based models provide rapid, cost-effective screening platforms for testing potential therapeutic compounds. Using the validated tmem237a morpholino (5′-TTGTCTGTGTGAAAGGCAGAAATCA-3′), researchers can generate embryos with ciliary defects and assess whether candidate compounds ameliorate the phenotypes .

Stable genetic mutants created through CRISPR/Cas9 genome editing offer more consistent models for long-term studies and drug testing. Such models would allow assessment of both developmental and post-developmental therapeutic interventions.

Transgenic reporter lines expressing fluorescent proteins under control of the tmem237a promoter or as fusion proteins can enable live imaging of ciliary dynamics and response to treatments. This approach facilitates high-throughput screening and real-time monitoring of therapeutic effects.

The optical transparency and external development of zebrafish embryos allow direct observation of organ development and function without invasive procedures. This feature is particularly valuable for assessing therapeutic effects on brain, kidney, and retinal phenotypes relevant to ciliopathies.

Furthermore, the conservation of ciliary genes and pathways between zebrafish and humans enhances the translational potential of findings from zebrafish models to human patients with TMEM237 mutations or other ciliopathies.

What emerging technologies could advance tmem237a research?

Several cutting-edge technologies hold promise for deepening our understanding of tmem237a biology and function:

Cryo-electron microscopy (cryo-EM) could reveal the detailed molecular structure of tmem237a and its integration within the ciliary transition zone complex. Structural insights would enhance our understanding of how mutations disrupt protein function and guide structure-based drug design for ciliopathies.

Proximity labeling approaches such as BioID or APEX can map the detailed protein interaction network of tmem237a within living cells. These techniques would provide temporal and spatial resolution of protein interactions that traditional methods lack, offering insights into the dynamic protein complexes in which tmem237a participates.

Single-cell RNA sequencing of tmem237a mutant or morphant embryos could identify cell type-specific consequences of tmem237a dysfunction and reveal compensatory transcriptional responses. This approach would help explain phenotypic variability and identify potential therapeutic targets.

Advanced imaging techniques, including super-resolution microscopy and light sheet microscopy, can visualize ciliary dynamics and transition zone architecture with unprecedented detail. These methods could reveal subtle defects in ciliary structure and function that conventional microscopy might miss.

CRISPR-based screens could identify genetic modifiers of tmem237a function, potentially revealing new therapeutic targets or explaining variable expressivity in human patients with TMEM237 mutations.

What aspects of tmem237a biology remain poorly understood?

Despite progress in understanding tmem237a function, several important aspects remain to be elucidated:

The precise molecular mechanism by which tmem237a contributes to transition zone formation and maintenance requires further investigation. While we know it localizes to this region and is required for ciliogenesis, the specific structural or functional role it plays within this complex remains unclear.

The functional divergence between tmem237a and tmem237b in zebrafish represents an important evolutionary question. Understanding why zebrafish maintain two paralogs and whether they have developed specialized functions could provide insights into the evolution of ciliary components.

The mechanism by which tmem237a dysfunction leads to Wnt signaling deregulation needs clarification . The connection between the ciliary transition zone and Wnt pathway regulation represents an important area for future research with potential therapeutic implications.

The tissue-specific requirements for tmem237a function remain incompletely characterized. While interactions with retinal proteins suggest important functions in photoreceptors , comprehensive analysis across tissues would enhance our understanding of ciliopathy phenotypes.

The potential role of tmem237a in non-ciliary contexts has not been fully explored. Many ciliary proteins have additional functions outside of cilia, and investigating such roles for tmem237a could reveal unexpected aspects of its biology.

How might integrative approaches enhance tmem237a research?

Integrative research approaches combining multiple disciplines and methodologies could significantly advance our understanding of tmem237a:

Systems biology approaches integrating proteomic, transcriptomic, and genetic interaction data could position tmem237a within broader cellular networks. This holistic view would help identify key nodes for therapeutic intervention and explain pleiotropic effects of tmem237a dysfunction.

Comparative studies across model organisms (zebrafish, mouse, C. elegans) could highlight evolutionarily conserved and divergent aspects of tmem237 function. The search results indicate that C. elegans jbts-14 (ortholog of TMEM237) interacts with nphp-4 to control basal body-transition zone anchoring , suggesting conservation of core functions across distant species.

Combining structural biology with functional genomics could link protein structure to phenotypic consequences. Understanding how specific domains or residues contribute to tmem237a function would refine our molecular understanding and guide mutagenesis studies.

Correlating findings from model organisms with human patient data would enhance the translational relevance of basic research. Phenotypic analysis of zebrafish models with mutations corresponding to human TMEM237 variants could help explain clinical variability and predict disease progression.

Integrating developmental biology with cell biological approaches would clarify the temporal requirements for tmem237a function. This integration could distinguish between primary developmental defects and secondary consequences, informing the timing of potential therapeutic interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.