Recombinant Danio rerio Transmembrane protein 41A-A (tmem41aa)

What is tmem41aa and why is it important as a research target in zebrafish models?

Transmembrane protein 41A-A (tmem41aa) is a protein encoded in the Danio rerio (zebrafish) genome with the UniProt accession number Q502G2. The protein is also known by synonyms including tmem41a, and is associated with gene names si:dkeyp-30d5.3 and zgc:112259 . The full-length protein encompasses amino acids 23-281, with a complete sequence featuring multiple transmembrane domains as indicated by its hydrophobic amino acid composition .

Zebrafish has emerged as a crucial vertebrate model organism, designated as such by the National Institutes of Health, due to several experimental advantages including:

• Genetic tractability comparable to Drosophila

• Small size and low maintenance requirements

• Rapid developmental timeline

• Transparent embryos with external development

• Abundance of available mutant and transgenic lines

These characteristics make zebrafish particularly valuable for high-throughput screening approaches and whole-organism studies involving transmembrane proteins like tmem41aa . The protein's importance as a research target stems from its potential role in various cellular pathways and molecular functions, making it relevant for fundamental biological research and potentially for disease modeling studies.

What are the optimal storage and handling conditions for recombinant tmem41aa protein?

Recombinant tmem41aa requires specific storage and handling protocols to maintain stability and functionality. Based on established guidelines for this protein, researchers should:

• Storage Temperature: Store the protein at -20°C for routine use. For extended storage periods, maintain at -20°C or -80°C .

• Buffer Composition: The protein is typically supplied in a Tris-based buffer containing 50% glycerol, specifically optimized for tmem41aa stability .

• Aliquoting Protocol: To minimize freeze-thaw cycles, divide the stock into working aliquots immediately upon receipt. Working aliquots may be stored at 4°C for up to one week .

• Freeze-Thaw Considerations: Repeated freezing and thawing is strongly discouraged as it can compromise protein integrity. Multiple freeze-thaw cycles may lead to protein denaturation, aggregation, and loss of functional activity .

• Working Temperature: When performing experiments, maintain the protein on ice when not in use to minimize degradation.

For experimental reproducibility, it's essential to document all handling procedures, including thawing methods, temperature fluctuations, and time at different storage conditions.

How should researchers validate the identity and purity of recombinant tmem41aa before experimental use?

Validation of recombinant tmem41aa identity and purity requires a multi-method approach:

• SDS-PAGE Analysis: Run the protein on an appropriate percentage gel (typically 10-12%) alongside molecular weight markers. Recombinant tmem41aa should appear at the expected molecular weight, with consideration for any fusion tags (such as His-tags) that may affect migration .

• Western Blot Confirmation: Perform immunoblotting using antibodies specific to either tmem41aa or the fusion tag (e.g., anti-His antibody for His-tagged proteins). This confirms both the identity and integrity of the recombinant protein .

• Mass Spectrometry Verification: For definitive identification, tryptic digest followed by mass spectrometry analysis can verify the protein sequence against the expected amino acid composition (VFLPPGPQLHKQSHEGETTDAKDGDEPSEMETASSRLKFPSDLDELKEMAELLQFYKTEH TGYVLLLFCSAYLYKQAFAIPGSSFLNILAGALFGTWFGLLLTCVLTTVGATLCFLLSQA FGKHHIVKLFPDKVAmLQKKVEENRSSLFFFLLFLRFFPMSPNWFLNMTSPILNIPVTLF FMAVFIGLMPYNFICVQTGSmLSQISSLDDLFSWSVVLKLLLTACVALLPGALIRKYSTR HLHLDGLETNGLSQNKKNR) .

• Circular Dichroism: For structural validation, particularly for transmembrane proteins, circular dichroism can confirm proper protein folding and secondary structure elements.

• Functional Assays: Depending on the known functions of tmem41aa, specific activity assays should be employed to verify that the recombinant protein maintains its expected biochemical activity.

A quality validation report should document all these analyses with appropriate controls to ensure experimental reproducibility and reliable interpretation of subsequent experimental results.

What experimental approaches are most effective for investigating tmem41aa protein interactions in zebrafish models?

Investigating tmem41aa protein interactions in zebrafish requires a multi-faceted experimental approach:

• Co-Immunoprecipitation (Co-IP): This technique can identify direct protein-protein interactions with tmem41aa. When working with zebrafish models:

  • Use anti-tmem41aa antibodies or antibodies against tagged versions (His-tagged recombinant tmem41aa) to pull down protein complexes

  • Verify interactions using reciprocal Co-IP with antibodies against putative interacting partners

  • Include appropriate negative controls (IgG, unrelated proteins) to confirm specificity

• Proximity Ligation Assays (PLA): This technique allows visualization of protein interactions in situ:

  • Can be performed on fixed zebrafish tissue sections or cells

  • Requires specific antibodies against tmem41aa and potential interactors

  • Provides spatial information about where interactions occur within cells/tissues

• Yeast Two-Hybrid (Y2H) Screening:

  • Clone tmem41aa (or domains of interest) into appropriate Y2H vectors

  • Screen against zebrafish-specific cDNA libraries

  • Validate positive interactions using alternative methods

• CRISPR-Cas9 Genetic Modification:

  • Generate tmem41aa knockout zebrafish lines to assess loss-of-function effects

  • Create transgenic zebrafish expressing tagged tmem41aa (e.g., fluorescent protein fusions)

  • Analyze phenotypic changes and molecular pathway alterations

• Interactome Analysis:

  • Mass spectrometry-based approaches following pull-down of tmem41aa complexes

  • Analysis of differentially expressed/modified proteins in tmem41aa mutant vs. wild-type zebrafish

  • Consider comparing results with known interactors of related proteins (CHCHD8, SMCO4, KDELC2, ODF2B, LANCL3)

For rigorous research, combining multiple interaction detection methods provides stronger evidence and reduces method-specific artifacts. Documentation of all experimental parameters is essential for reproducibility.

How can researchers effectively design single-case experimental designs (SCEDs) for tmem41aa functional studies in zebrafish?

Designing effective SCEDs for tmem41aa functional studies requires careful methodological planning:

• Baseline Establishment:

  • Collect a minimum of 3-5 data points during baseline phases to establish stable pre-intervention measurements

  • Ensure baseline observations are representative of natural tmem41aa function or expression

  • Collect multiple parameters simultaneously (e.g., protein expression, localization, associated phenotypes)

• Phase Structure:

  • Implement a reversal design (ABAB) where:

    • A = baseline condition

    • B = experimental intervention (e.g., tmem41aa inhibition, overexpression)

  • This design requires at least four phases to demonstrate experimental control

  • Alternatively, use multiple baseline designs with replication across at least three conditions (e.g., different tissues, developmental stages, or genetic backgrounds)

• Intervention Fidelity:

  • Ensure consistent application of the intervention

  • Document intervention parameters (dosage, timing, delivery method)

  • Verify the intervention directly affects tmem41aa (e.g., through expression analysis)

• Data Collection Frequency:

  • Implement systematic, repeated measurements

  • Address potential autocorrelation (non-independence of sequential observations)

  • Standardize observation timing to control for developmental or circadian effects

• Randomization Component:

  • When possible, randomize phase transition timing

  • Randomly select measurement occasions within phases

  • Randomly assign intervention sequences when multiple interventions are tested

• Analysis Considerations:

  • Plan for both visual analysis and statistical approaches

  • Consider the short data streams common in zebrafish experiments

  • Address any missing observations with appropriate statistical methods

This approach aligns with contemporary SCED standards while adapting to the specific challenges of zebrafish tmem41aa research.

What methodological approaches can address the challenges of quantifying tmem41aa expression across different developmental stages in zebrafish?

Quantifying tmem41aa expression across developmental stages presents unique methodological challenges that can be addressed through:

• Temporal Sampling Strategy:

  • Establish precise developmental staging criteria (hours post-fertilization, morphological markers)

  • Implement systematic sampling at key developmental transitions

  • Include tightly-spaced time points during periods of rapid development

• RNA Quantification Methods:

  • qRT-PCR with stage-specific reference genes for normalization

  • RNA-Seq for genome-wide context of expression patterns

  • In situ hybridization for spatial localization of tmem41aa transcripts

  • Single-cell RNA-Seq to identify cell-type specific expression patterns

• Protein Quantification Approaches:

  • Western blot with densitometry analysis using stage-appropriate loading controls

  • Mass spectrometry-based quantification for absolute protein amounts

  • Immunohistochemistry for spatial protein distribution

  • Live imaging of fluorescently-tagged tmem41aa in transgenic lines

• Reference Standards:

  • Include recombinant tmem41aa protein standards for absolute quantification

  • Use multiple reference genes/proteins verified for stability across developmental stages

  • Implement spike-in controls for normalization between samples

• Data Normalization Strategies:

  • Normalize to total protein amount for different sized embryos/larvae

  • Account for changing cell numbers during development

  • Consider tissue-specific normalization for organ-focused analyses

• Statistical Analysis:

  • Apply time-series analysis methods appropriate for developmental data

  • Account for non-independence of sequential developmental stages

  • Use mixed-effects models to separate individual-level and stage-level variation

This comprehensive approach enables reliable quantification while addressing the biological complexities of developmental expression.

What are the key experimental controls required when studying recombinant tmem41aa in zebrafish systems?

Robust experimental design for tmem41aa research requires multi-level control implementation:

• Negative Controls:

  • Vehicle-only treatments (matching buffer composition without protein)

  • Irrelevant recombinant proteins of similar size/structure to control for non-specific effects

  • Non-targeting constructs in genetic manipulation studies

  • Wild-type zebrafish strains alongside experimental groups

• Positive Controls:

  • Known modulators of pathways involving tmem41aa

  • Well-characterized phenotypes in relevant tissues/systems

  • Previously validated interacting partners of tmem41aa

• Specificity Controls:

  • Rescue experiments following knockdown/knockout (using recombinant tmem41aa)

  • Concentration-response relationships to verify specific effects

  • Multiple independent methods targeting tmem41aa function

• Technical Controls:

  • Multiple reference genes for qPCR normalization

  • Loading controls for Western blots

  • Staining controls for immunohistochemistry/immunofluorescence

  • Antibody validation (using knockout/knockdown samples)

• Biological Replication:

  • Independent biological replicates (different clutches of embryos)

  • Experiments performed across different times/days

  • Verification across multiple zebrafish lines

• Developmental Controls:

  • Precise staging of embryos/larvae

  • Control for potential developmental delays caused by manipulations

  • Inclusion of developmental marker genes/proteins

• Environmental Controls:

  • Standardized housing conditions (temperature, light cycles, water quality)

  • Consistent feeding regimens

  • Tracking of environmental variables that may influence results

These controls help distinguish specific tmem41aa-related effects from experimental artifacts and natural biological variation.

How should researchers design high-throughput screening (HTS) protocols to investigate tmem41aa function in zebrafish models?

Designing effective HTS protocols for tmem41aa function requires systematic optimization:

• Assay Selection and Development:

  • Choose endpoints directly linked to tmem41aa function

  • Develop assays amenable to automation and quantitative readouts

  • Validate assay performance metrics (Z-factor, signal-to-background ratio, coefficient of variation)

• Zebrafish Model Preparation:

  • Use transgenic lines expressing fluorescent reporters relevant to tmem41aa pathways

  • Consider tmem41aa knockout/knockdown models with rescued expression

  • Optimize embryo collection, handling, and positioning for consistent imaging

• Screening Platform Selection:

  • Microplate-based systems for chemical/drug screening

  • Automated microscopy for morphological/reporter readouts

  • Consider high-content screening (HCS) systems for multi-parameter analysis

• Sample Size and Layout:

  • Determine minimum sample size for statistical power

  • Implement randomized plate layouts to control for position effects

  • Include internal controls on each plate for normalization

• Screening Protocol Optimization:

  Parameter	Consideration	Recommendation
  Developmental stage	Target stage for maximal tmem41aa expression	Stage-specific, based on preliminary expression data
  Compound concentration	Balance between efficacy and toxicity	5-point dose series, typically 0.1-30 μM
  Exposure duration	Time required for phenotype development	24-72 hours, with multiple observation timepoints
  Sample number	Statistical power requirements	Minimum n=8 per condition, replicated in independent experiments
  Controls	Validation of assay performance	Positive, negative, and vehicle controls on each plate

• Data Analysis Pipeline:

  • Develop automated image analysis workflows (for morphological/reporter readouts)

  • Implement quality control filters to exclude low-quality samples

  • Apply appropriate statistical methods for hit identification and validation

  • Consider machine learning approaches for complex phenotypes

• Hit Validation Strategy:

  • Secondary assays to confirm primary hits

  • Dose-response characterization

  • Orthogonal assays to verify mechanism

  • Target engagement studies with recombinant tmem41aa

This structured approach maximizes the efficiency and reliability of HTS for tmem41aa functional investigation.

What considerations should guide the design of experiments investigating tmem41aa protein-membrane interactions?

Investigating tmem41aa protein-membrane interactions requires specialized experimental design:

• Membrane System Selection:

  • Native membranes (from zebrafish tissues/cells)

  • Artificial membrane systems (liposomes, bicelles, nanodiscs)

  • Planar lipid bilayers for electrophysiology

  • Each system offers tradeoffs between physiological relevance and experimental control

• Lipid Composition Considerations:

  • Match lipid composition to the native environment of tmem41aa

  • Systematically vary lipid composition to identify specific interactions

  • Include relevant sterols and phospholipids found in zebrafish membranes

  • Consider developmental changes in membrane composition

• Protein Preparation:

  • Recombinant tmem41aa requires careful handling to maintain native conformation

  • Consider using the full protein (amino acids 23-281) to preserve all membrane-interacting domains

  • Evaluate the impact of tags (His-tag) on membrane interactions

  • Establish proper refolding protocols if needed

• Interaction Analysis Techniques:

  • Fluorescence-based assays (FRET, anisotropy) for dynamic measurements

  • Surface plasmon resonance for binding kinetics

  • Microscopy approaches for membrane localization (TIRF, confocal)

  • Molecular dynamics simulations to predict interaction sites

• Experimental Variables to Control:

  Variable	Impact	Control Method
  pH	Affects protein conformation and charge	Buffer with appropriate pKa for physiological pH
  Temperature	Influences membrane fluidity and protein dynamics	Maintain at zebrafish physiological temperature (28°C)
  Ionic strength	Affects electrostatic interactions	Use physiologically relevant salt concentrations
  Membrane curvature	May alter protein insertion/function	Control liposome size or use supported bilayers
  Protein:lipid ratio	Critical for proper incorporation	Titrate to determine optimal ranges

• Validation Approaches:

  • Site-directed mutagenesis of predicted membrane-interacting residues

  • Competition assays with peptides derived from transmembrane domains

  • Crosslinking studies to capture transient interactions

  • Compare wild-type and disease-associated variants

• Data Analysis Considerations:

  • Develop binding models appropriate for membrane proteins

  • Account for cooperative binding if present

  • Consider kinetic and thermodynamic parameters separately

  • Validate with multiple independent techniques

This comprehensive approach addresses the complex nature of transmembrane protein-lipid interactions while maintaining experimental rigor.

What statistical approaches are most appropriate for analyzing time-series data in tmem41aa expression studies?

Time-series data from tmem41aa expression studies present unique analytical challenges requiring specialized statistical approaches:

• Autocorrelation Analysis:

  • Assess temporal dependence between observations

  • Apply autocorrelation function (ACF) and partial autocorrelation function (PACF) analyses

  • Address autocorrelation through appropriate statistical models to prevent inflated Type I error rates

• Visual Analysis Methods:

  • Systematic visual inspection remains a foundational approach

  • Evaluate level, trend, variability, immediacy of effects, and overlap between phases

  • Supplement with statistical analyses for objective verification

• Parametric Time-Series Models:

  • Autoregressive integrated moving average (ARIMA) models

  • Account for trend, seasonality, and random variation components

  • Particularly useful for longer time-series with sufficient data points

• Non-Parametric Approaches:

  • Randomization tests for experimental designs with intervention components

  • Tau-U analysis for controlling baseline trends and phase overlap

  • Percentage of non-overlapping data (PND) and related metrics

• Single-Case-Specific Methods:

  • Interrupted time-series analysis for intervention studies

  • Piecewise regression for identifying change points in expression

  • Level and trend change models to quantify intervention effects

• Hierarchical/Multilevel Models:

  • Account for nested data structures (e.g., cells within tissues, tissues within organisms)

  • Allow for random effects at multiple levels

  • Can incorporate covariates such as developmental stage or experimental conditions

• Statistical Power Considerations:

  • For single-case designs, a minimum of 3-5 data points per phase is recommended

  • Power analysis should account for autocorrelation structure

  • Consider sequential analysis approaches for ongoing data collection

• Effect Size Calculation:

  • Standardized mean difference for level changes

  • Slope/trend effect sizes for rate of change

  • Non-overlap metrics (NAP, Tau-U) for distribution separation

This comprehensive analytical framework aligns with contemporary standards in single-case experimental design while addressing the specific challenges of tmem41aa expression data .

How can researchers effectively integrate data from multiple experimental approaches to characterize tmem41aa function?

Effective integration of multi-modal experimental data for tmem41aa characterization requires systematic triangulation approaches:

• Cross-Validation Framework:

  • Establish consistent criteria for evaluating evidence across methods

  • Weight findings based on methodological rigor and reproducibility

  • Identify convergent findings that appear across multiple techniques

• Multi-Omics Data Integration:

  • Combine transcriptomic, proteomic, and functional data

  • Apply pathway analysis tools to position tmem41aa within cellular networks

  • Utilize visualization tools that allow overlaying different data types

• Integration Strategies:

  Data Type	Integration Approach	Software/Tools
  Transcriptomic	Co-expression network analysis	WGCNA, Cytoscape
  Proteomic	Protein-protein interaction mapping	STRING, BioGRID
  Phenotypic	Ontology-based annotation and clustering	Zebrafish Phenotype Ontology
  Structural	Molecular modeling with functional mapping	PyMOL, UCSF Chimera
  Genetic	Epistasis analysis and genetic interaction mapping	GeneMania, GeneMANIA

• Bayesian Approaches:

  • Develop Bayesian models that incorporate prior knowledge

  • Update probability estimates as new evidence emerges

  • Account for varying levels of uncertainty across experimental approaches

• Meta-Analysis Methods:

  • When multiple similar experiments exist, apply formal meta-analysis

  • Use fixed or random effects models depending on heterogeneity

  • Calculate combined effect sizes with confidence intervals

• Systems Biology Framework:

  • Develop mathematical models of pathways involving tmem41aa

  • Test model predictions with targeted experiments

  • Iteratively refine models based on new experimental data

• Contradiction Resolution Protocol:

  • Systematically evaluate contradictory findings

  • Consider methodological differences that might explain discrepancies

  • Design critical experiments to specifically address contradictions

  • Weight evidence by methodological strength and reproducibility

• Visualization Strategies:

  • Develop integrated visualizations showing multiple data dimensions

  • Use consistent color schemes and symbols across data representations

  • Create interactive visualizations for exploring complex relationships

This structured integration approach provides a comprehensive understanding of tmem41aa function while acknowledging the strengths and limitations of individual experimental methods.

What approaches can researchers use to address data contradictions in tmem41aa functional studies?

Resolving data contradictions in tmem41aa research requires systematic methodological investigation:

This structured approach transforms contradictions from research obstacles into opportunities for deeper understanding of tmem41aa biology.

What are the current knowledge gaps and future research directions for tmem41aa in zebrafish models?

Current knowledge gaps and promising research directions for tmem41aa in zebrafish include:

• Structural-Functional Relationships:

  • Detailed structural characterization of transmembrane domains and their specific roles

  • Structure-guided mutagenesis to identify critical functional residues

  • Comparative analysis with mammalian orthologs to identify conserved functional domains

• Developmental Regulation:

  • Comprehensive spatiotemporal expression mapping throughout zebrafish development

  • Regulatory mechanisms controlling tmem41aa expression

  • Functional significance of expression pattern changes during development

• Pathway Integration:

  • Identification of complete signaling networks involving tmem41aa

  • Characterization of protein-protein interactions in different cellular contexts

  • Integration of tmem41aa function with known cellular pathways

• Physiological Functions:

  • Tissue-specific roles in zebrafish development and homeostasis

  • Functional redundancy with related proteins (e.g., CHCHD8, SMCO4, KDELC2)

  • Physiological consequences of tmem41aa dysfunction

• Disease Relevance:

  • Potential contributions to vertebrate disease states

  • Development of disease models based on tmem41aa mutations

  • Exploration of therapeutic approaches targeting tmem41aa pathways

• Technological Advancement Needs:

  • Development of highly specific antibodies for zebrafish tmem41aa

  • Creation of reporter lines for dynamic visualization of expression

  • Advanced imaging techniques for tracking tmem41aa localization in vivo

• Methodological Improvements:

  • Standardized protocols for functional studies across laboratories

  • Improved statistical approaches for analyzing complex experimental designs

  • Development of high-throughput phenotypic screens specific for tmem41aa function

These research directions will contribute to a comprehensive understanding of tmem41aa biology while addressing current methodological and knowledge limitations in the field.

How should researchers approach the integration of tmem41aa findings from zebrafish models to broader vertebrate biology?

Translating tmem41aa findings from zebrafish to broader vertebrate biology requires systematic comparative approaches:

• Evolutionary Conservation Analysis:

  • Comprehensive sequence alignment across vertebrate species

  • Identification of conserved domains and critical residues

  • Phylogenetic analysis to understand evolutionary relationships

• Cross-Species Functional Comparison:

  • Complementation studies using orthologs from different species

  • Evaluation of functional conservation in different cellular contexts

  • Analysis of species-specific interaction partners

• Model Translation Framework:

  Translation Level	Approach	Evaluation Metrics
  Molecular	Compare biochemical properties of orthologs	Binding affinities, protein stability, post-translational modifications
  Cellular	Assess subcellular localization and interactions	Co-localization patterns, interaction networks, trafficking dynamics
  Physiological	Compare phenotypes in multiple model organisms	Severity, penetrance, tissue specificity of phenotypes
  Disease relevance	Evaluate mutations in disease contexts	Genotype-phenotype correlations across species

• Comparative Expression Analysis:

  • Compare expression patterns across developmental stages in multiple species

  • Identify conserved regulatory elements controlling expression

  • Analyze tissue-specificity conservation across vertebrates

• Translational Experimental Design:

  • Develop parallel experimental protocols applicable across species

  • Design experiments that test evolutionary conservation hypotheses

  • Implement consistent phenotyping approaches across model systems

• Integrative Data Resources:

  • Contribute to and utilize cross-species databases

  • Develop visualization tools for comparing findings across organisms

  • Create unified nomenclature and ontologies for cross-species comparisons

• Collaborative Research Frameworks:

  • Establish research consortia focused on multi-species approaches

  • Standardize methods and reporting for cross-species comparison

  • Implement data sharing protocols to facilitate integration

• Limitations and Constraints:

  • Acknowledge species-specific differences in interpretation

  • Consider evolutionary divergence in pathway components

  • Account for differences in experimental accessibility between models