Recombinant Danio rerio Transmembrane protein 45B (tmem45b)

Shipped with Ice Packs
In Stock

Description

Biological Significance

TMEM45B is implicated in cancer progression and developmental processes, though its exact mechanisms remain under investigation.

Cancer-Related Roles

  • Oncogenic Activity: Overexpression in osteosarcoma cells correlates with increased proliferation, migration, and invasion. Knockdown suppresses these processes via downregulation of β-catenin, cyclin D1, and c-Myc, partially through the Wnt/β-catenin pathway .

  • Metastasis: Silencing TMEM45B in osteosarcoma models reduces tumor growth in vivo, highlighting its role in metastatic progression .

  • Gastric Cancer: In human gastric cancer cell lines, TMEM45B knockdown decreases proliferation and invasion while upregulating E-cadherin and downregulating N-cadherin and vimentin, suggesting involvement in the JAK/STAT3 pathway .

Cancer TypeObserved EffectPathwaySource
Osteosarcoma↑ Proliferation, migration, invasion; ↓ Tumor growth upon knockdownWnt/β-catenin
Gastric Cancer↓ Proliferation, invasion; ↑ E-cadherin, ↓ N-cadherin, vimentinJAK/STAT3
Lung/Pancreatic↑ Metastasis; proposed as a biomarker for metastatic melanoma/prostate cancerCell cycle regulation

Production and Purification

Recombinant TMEM45B is synthesized using heterologous expression systems for research and therapeutic applications.

ParameterDetailSource
Expression SystemE. coli (in vitro)
PurificationAntigen-affinity chromatography (e.g., via poly-His tags)
ApplicationsELISA, Western blot, functional assays (e.g., proliferation, migration)

Challenges:

  • Low Solubility: Predicted thermal aggregation may hinder large-scale production .

  • Post-Translational Modifications: Limited data on glycosylation or phosphorylation in recombinant forms.

Research Applications

Recombinant TMEM45B is utilized in functional studies and detection assays.

ApplicationMethodOutcomeSource
Expression AnalysisqRT-PCR, Western blotQuantification of TMEM45B mRNA/protein levels in cell lines or tissues
Functional StudiesCRISPR/Cas9 knockdownSuppression of proliferation, migration, and invasion in cancer models
Antibody DevelopmentRabbit polyclonal antibodiesDetection of TMEM45B in zebrafish lysates or cell cultures
In Vivo ModelsXenograft tumor assaysEvaluation of tumor growth and metastasis in nude mice

Genomic Information

  • Chromosome: 11q24.3 (human ortholog) .

  • Transcript Variants: Multiple isoforms predicted, though annotation remains incomplete .

Proteomic Interactions

  • Interactors: Limited direct interaction data; inferred roles via pathway analysis (e.g., Wnt/β-catenin) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem45b; zgc:77892; Transmembrane protein 45B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem45b
Target Protein Sequence
MANFKGHALPGTFFLLFGLWWSIKCPFRQILRRKERQVGDRERQKLTALFNRIDLIEGSL KIFFAFVGIMAEQFVPDGPHAHLYQDGWVKLMNWQHSTMYLFYGISGIADVLSVSSHHVP VGLDRLFLSLALFVEGFLFYFHIHNREPLDQHIHSLLLFAVFGGSASTMMEVFKRENAVL ELLRCTLAILQGTWFYQIGFVLYPLSGPEWDLTRHDNIMFITMCFCWHLAVALLIVGICY CGVFWTSKWCERRQRGDMEMGLRKSTSTDSSSQKALLQESDEE
Uniprot No.

Target Background

Database Links
Protein Families
TMEM45 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant tmem45b?

Recombinant tmem45b can be successfully produced using in vitro E. coli expression systems. For optimal purification and detection, the protein can be expressed with an N-terminal 10xHis tag. When designing expression constructs, researchers should target the full-length protein (amino acids 1-283) to maintain proper folding and function .

What are the optimal storage conditions for recombinant tmem45b?

Recombinant tmem45b should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C. Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may compromise protein stability. The shelf life varies based on formulation—liquid preparations maintain integrity for approximately 6 months at -20°C/-80°C, while lyophilized forms remain viable for up to 12 months under the same conditions .

What detection methods are available for tmem45b in tissue samples?

Multiple complementary approaches can be employed to detect tmem45b in tissue samples:

  • Immunohistochemistry: Custom antibodies developed against specific peptide sequences, such as amino acids 264-278, have been successfully used for immunostaining .

  • Fluorescence in situ hybridization: Digoxigenin-labeled cRNA probes can effectively detect tmem45b mRNA in tissue sections .

  • Western blot analysis: Standard western blotting protocols can detect the protein in tissue lysates, though researchers should be aware of the thermal aggregation properties that may affect band patterns .

  • Quantitative RT-PCR: For mRNA expression analysis, qRT-PCR using the LightCycler480 system has been successfully employed to quantify tmem45b transcript levels across different tissues .

Why does tmem45b show abnormal behavior in SDS-PAGE analysis, and how can this be addressed?

Tmem45b exhibits clear thermal aggregation properties when subjected to SDS-PAGE, which is a relatively rare phenomenon for membrane proteins. This behavior is attributed specifically to the 4th through 7th transmembrane domains. When heated during sample preparation, these domains cause the protein to aggregate rather than migrate according to its molecular weight .

To address this challenge, researchers can:

  • Modify sample preparation by reducing heating time or temperature

  • Use native PAGE instead of SDS-PAGE when appropriate

  • Focus on specific domains that don't exhibit thermal aggregation

  • Consider using this property as a positive control for thermal aggregation studies

  • Employ the 4th-7th transmembrane domains as a fusion tag to confer thermal aggregation properties to other proteins

What considerations are important when generating tmem45b knockout models?

When developing tmem45b knockout models, researchers should implement the following validation steps:

  • Genetic verification: Confirm the knockout at the genomic level through PCR and/or sequencing

  • Expression analysis: Validate the absence of protein using western blot and immunohistochemistry

  • Phenotypic assessment: Evaluate basic motor function, gait, and reflexes to ensure no overt defects

  • Baseline sensory testing: Measure responses to thermal and mechanical stimuli under normal conditions

  • Pain model testing: Assess responses in various pain models, including inflammatory, incisional, and neuropathic paradigms

  • Sex-specific analysis: Include both male and female animals to identify any sex-dependent effects

Previous tmem45b knockout mice were viable with no obvious motor or reflex impairments, suggesting minimal developmental concerns .

What is the neuroanatomical distribution of tmem45b?

Tmem45b is primarily expressed in peripheral sensory neurons, with particularly strong expression in IB4+ sensory neurons. This specific expression pattern is critical for understanding its role in nociception and pain processing. Researchers investigating tmem45b should consider this restricted tissue distribution when designing experiments and interpreting results, as it suggests a specialized function in sensory processing rather than a general housekeeping role .

How does tmem45b contribute to nociception and pain processing?

Tmem45b plays a selective and essential role in mechanical pain hypersensitivity following inflammation or tissue injury, but is not involved in baseline nociception or thermal pain hypersensitivity. This functional specificity has been demonstrated through multiple experimental approaches:

Pain ConditionPain ModalityResponse in tmem45b-KO MiceSignificance
Normal/BaselineMechanicalNormalTmem45b not required for acute mechanical nociception
Normal/BaselineThermalNormalTmem45b not required for thermal nociception
CFA-InflammationMechanicalAbolished hypersensitivityTmem45b essential for inflammatory mechanical hypersensitivity
CFA-InflammationThermalNormal hypersensitivityTmem45b not involved in thermal hypersensitivity
Tissue InjuryMechanicalAbolished hypersensitivityTmem45b essential for post-incisional mechanical hypersensitivity
NeuropathicMechanicalNormal hypersensitivityTmem45b not involved in neuropathic mechanical hypersensitivity

This selective involvement in specific pain modalities and conditions makes tmem45b an attractive target for modality-specific pain management strategies .

How can the thermal aggregation property of tmem45b be leveraged in research applications?

The distinctive thermal aggregation behavior of tmem45b offers unique research opportunities:

  • Model system: Tmem45b can serve as a clear model for studying thermal aggregation mechanisms in membrane proteins

  • Domain transfer: The 4th-7th transmembrane domains can be used as modular elements to confer thermal aggregation properties to other proteins

  • Structural studies: Investigating these domains may provide insights into protein-protein interactions that drive thermal aggregation

  • Assay development: This property could be exploited for developing novel protein interaction assays based on aggregation behavior

  • Protein engineering: Understanding the molecular basis of this behavior may inform protein engineering approaches aimed at increasing protein stability

What are the therapeutic implications of targeting tmem45b for pain management?

Tmem45b represents a promising therapeutic target for selective management of mechanical pain hypersensitivity for several key reasons:

  • Modality specificity: Targeting tmem45b would selectively reduce mechanical pain hypersensitivity while preserving thermal pain sensation and normal mechanical nociception

  • Preservation of warning signals: Tmem45b knockdown does not affect sensitivity to physiological pain, which serves as a vital warning signal

  • Peripheral expression: Tmem45b is primarily expressed in peripheral sensory neurons rather than central neurons, potentially limiting central nervous system side effects

  • Selective pathological involvement: Tmem45b appears specifically involved in inflammatory and incisional pain but not neuropathic pain, allowing for condition-specific targeting

  • Effectiveness of RNA interference: siRNA approaches have already demonstrated efficacy in reducing tmem45b-dependent pain, suggesting RNAi therapeutics as a viable approach

How do species differences in tmem45b expression and function impact translational research?

While zebrafish tmem45b has been characterized at the molecular level, functional studies have primarily utilized mouse models. When conducting translational research, several species-specific considerations must be addressed:

  • Neurochemical heterogeneity: IB4+ sensory neurons, which express tmem45b, show greater neurochemical heterogeneity in rats than in mice, potentially leading to species-dependent functional differences

  • Pain behavior discrepancies: Ablation of IB4+ sensory neurons affects thermal nociception in rats but not in mice, suggesting species differences in nociceptive circuitry

  • Protein conservation: Sequence homology analysis between zebrafish and mammalian tmem45b should be conducted to assess functional conservation

  • Expression patterns: Comparative expression mapping is needed to confirm similar tissue distribution across species

  • Drug target validation: Pharmacological studies should validate tmem45b as a target across multiple species before advancing to human studies

What controls are essential when studying tmem45b in pain models?

Robust experimental design for tmem45b pain studies should include the following controls:

  • Wild-type comparisons: Age-matched, sex-matched wild-type animals subjected to identical pain models

  • Multiple pain modalities: Assessment of both thermal and mechanical pain to confirm modality-specific effects

  • Multiple time points: Evaluation at various time points to capture both acute and chronic phases

  • Inflammatory markers: Measurement of edema or other inflammatory indicators to ensure comparable inflammation between groups

  • Multiple pain models: Testing across inflammatory, incisional, and neuropathic models to distinguish mechanisms

  • Intervention controls: Appropriate controls for any interventions (e.g., scrambled siRNA for knockdown studies)

  • Sex-balanced cohorts: Both male and female animals to identify any sex-dependent effects

What are the common pitfalls in tmem45b expression analysis, and how can they be avoided?

Several challenges can complicate tmem45b expression analysis:

  • Thermal aggregation interference: Western blot analysis may show unexpected band patterns due to thermal aggregation. Solution: Modify sample preparation protocols or use non-denaturing conditions.

  • Antibody specificity: Custom antibodies may show cross-reactivity. Solution: Validate antibody specificity using knockout tissue as a negative control.

  • Low expression levels: Tmem45b may be expressed at low levels in some tissues. Solution: Use sensitive detection methods like RNAscope or qRT-PCR with appropriate amplification cycles.

  • Cellular heterogeneity: Bulk tissue analysis may mask cell-type specific expression. Solution: Employ single-cell RNA sequencing or laser capture microdissection of specific neuronal populations.

  • Developmental regulation: Expression patterns may change during development. Solution: Analyze expression across multiple developmental timepoints .

How should researchers approach dose-finding studies for tmem45b-targeting therapeutics?

When developing tmem45b-targeting therapeutics, researchers should implement a systematic dose-finding approach:

  • In vitro potency: Establish dose-response relationships in cell culture models expressing tmem45b

  • Target engagement: Confirm target binding/knockdown across multiple concentrations

  • Effect threshold: Determine the minimum effective dose that reduces mechanical pain hypersensitivity

  • Therapeutic window: Establish the range between effective doses and doses causing adverse effects

  • Temporal considerations: Assess both acute and chronic dosing regimens to identify tolerance or sensitization effects

  • Route of administration: Compare effectiveness across different administration routes (e.g., intrathecal, intraplantar, systemic)

  • Sex-specific responses: Evaluate potential sex-dependent differences in drug responses

  • Species translation: Establish allometric scaling factors for translation between model organisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.