Recombinant Danio rerio Transmembrane protein 53 (tmem53)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Danio rerio Transmembrane protein 53 (Tmem53) is a protein derived from the zebrafish (Danio rerio), specifically produced using recombinant DNA technology . Tmem53 is also found in other organisms such as mice, rats, and humans . It is also known as transmembrane protein 53 .

Characteristics:

  • Source: Produced in vitro using an E. coli expression system .

  • Tag Information: Contains an N-terminal 10xHis-tag .

  • Sequence: The protein consists of 281 amino acids with the following sequence: MGDDDLDYNIVFSEALISEKHWRGSKEPVVILLGWAGSRDKHLAKYSSIYNEQGCTTLRYTAPLKTVFISESLGYKELRSTAHKLLELLYDYEVENNPIFFHVFSNGGFMLYRYMVELLHSHKQFSTLCVVGTVVDSAPGSQNVVGALRALKTTLGPKVNVLLQYFLLALFAVAVFLLRIVLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMVESFD FITPAHVSLFRDCPEDYSNRCRTFLSHCMTTSEEILMKKHH .

  • UniProt Number: Q6DHN0

Function and Expression

Tmem53 is a transmembrane protein, meaning it spans the cell membrane . Mouse studies indicate that Tmem53 is abundantly expressed in tissues rich in highly ciliated cells, such as olfactory sensory neurons . In osteoblast lineage cells, Tmem53 negatively regulates bone morphogenetic protein (BMP) signaling by preventing the translocation of phosphorylated SMAD proteins from the cytoplasm to the nucleus .

Role in Bone Disorders

Research indicates that deficiency in TMEM53 can lead to sclerosing bone disorders due to the dysregulation of BMP-SMAD signaling .

Key findings:

  • Individuals with homozygous TMEM53 pathogenic variants exhibit normal development until late-onset short stature .

  • Craniofacial dysmorphisms, such as a tall forehead and hypertelorism, are observed in both affected individuals and Tmem53 mutant mice .

  • TMEM53 deficiency promotes osteoblast differentiation by overactivating BMP signaling .

  • TMEM53 prevents the nuclear accumulation of SMAD1/5/9, which are essential for BMP signaling .

TMEM53 and BMP Signaling Pathway

TMEM53 affects the BMP signaling pathway, which is critical for bone formation and development . TMEM53 appears to inhibit the activation of the SMAD-dependent BMP signaling pathway . Studies using TMEM53 knockout human cell lines showed that BMP signaling activity was upregulated in the absence of TMEM53 and downregulated when TMEM53 was overexpressed .

Animal Studies

Experiments using Tmem53-deficient mice have provided further insights into the function of this protein . The mutant mice exhibited similar skeletal features to those observed in humans with TMEM53 pathogenic variants, including late-onset short stature, craniofacial dysmorphisms, and platyspondyly . The Tmem53 mutant mice also displayed thickening of the growth plate in the femur, suggesting that Tmem53 deficiency promotes chondrogenesis in the growth plate by overactivating BMP signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem53; zgc:92204; Transmembrane protein 53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem53
Target Protein Sequence
MGDDDLDYNIVFSEALISEKHWRGSKEPVVILLGWAGSRDKHLAKYSSIYNEQGCTTLRY TAPLKTVFISESLGYKELRSTAHKLLELLYDYEVENNPIFFHVFSNGGFMLYRYMVELLH SHKQFSTLCVVGTVVDSAPGSQNVVGALRALKTTLGPKVNVLLQYFLLALFAVAVFLLRI VLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMVESFD FITPAHVSLFRDCPEDYSNRCRTFLSHCMTTSEEILMKKHH
Uniprot No.

Target Background

Database Links
Protein Families
TMEM53 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of zebrafish tmem53?

Danio rerio tmem53 is a transmembrane protein belonging to the TMEM53 family with 281 amino acids and a molecular mass of approximately 32.5 kDa. The protein's complete amino acid sequence is:
MGDDDLDYNIVFSEALISEKHWRGSKEPVVILLGWAGSRDKHLAKYSSIYNEQGCTTLRYTAPLKTVFISESLGYKELRSTAHKLLELLYDYEVENNPIFFHVFSNGGFMLYRYMVELLHSHKQFSTLCVVGTVVDSAPGSQNVVGALRALKTTLGPKVNVLLQYFLLALFAVAVFLLRIVLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMVESFDFITPAHVSLFRDCPEDYSNRCRTFLSHCMTTSEEILMKKHH

When analyzing this protein structure, researchers should examine the transmembrane domains using prediction algorithms such as TMHMM or Phobius to identify membrane-spanning regions, which is critical for understanding protein topology and function in cellular membranes.

How does zebrafish tmem53 compare to human TMEM53?

While the search results don't directly compare zebrafish tmem53 to human TMEM53, researchers should perform sequence alignment using tools like BLAST or Clustal Omega to determine sequence homology. Conservation analysis between species can reveal functionally important domains. Typically, transmembrane regions show higher conservation than loop regions, which can help identify critical functional domains for mutational studies. This comparative approach is essential when using zebrafish as a model for human disease research, as zebrafish and humans share many genetic pathways controlling signal transduction and development .

What expression patterns does tmem53 show during zebrafish development?

To determine expression patterns, researchers should perform whole-mount in situ hybridization (WISH) at various developmental stages using antisense RNA probes designed from the tmem53 sequence. Complementary approaches should include RT-qPCR for quantitative temporal expression and immunohistochemistry with anti-tmem53 antibodies for protein localization. Similar approaches have been used successfully to characterize expression patterns of other zebrafish genes like tp53 . Based on zebrafish developmental biology principles, monitoring expression in early embryogenesis (4-72 hours post-fertilization) is particularly informative for understanding potential roles in tissue differentiation and organogenesis.

What are effective approaches for knocking down tmem53 expression in zebrafish?

For transient knockdown studies, antisense morpholino oligonucleotides (MOs) targeting the tmem53 translation start site or splice junctions can be microinjected into one-cell stage embryos. This approach has been successfully used in zebrafish to study other genes' functions, as demonstrated in MPS II pathogenesis studies . For more specific results, design at least two different MOs targeting different sites to confirm specificity of the phenotype.

For stable genetic knockout models, CRISPR/Cas9 offers a superior approach:

  • Design multiple sgRNAs targeting exons within tmem53's DNA-binding domain

  • Co-inject sgRNAs with Cas9 mRNA into one-cell stage embryos

  • Screen F0 founders for germline transmission using high-resolution melting analysis

  • Establish F1 heterozygote lines and intercross to obtain homozygous mutants

Similar genetic approaches have been effective for generating zebrafish tp53 mutant lines , which subsequently enabled significant cancer research advances.

How can researchers validate tmem53 antibodies for zebrafish studies?

Validation of antibodies for zebrafish tmem53 should follow a multi-step approach:

  • Western blot analysis comparing wild-type and tmem53 knockdown/knockout samples to verify specificity

  • Immunoprecipitation followed by mass spectrometry to confirm target binding

  • Immunofluorescence microscopy comparing wild-type and knockdown samples

  • Use of epitope-tagged recombinant tmem53 as a positive control

Researchers must be cautious about antibody cross-reactivity, particularly when using antibodies raised against mammalian orthologs. Expression of tagged tmem53 constructs can serve as controls for antibody validation experiments.

What expression systems are most effective for producing recombinant zebrafish tmem53?

For functional studies requiring recombinant tmem53, researchers should consider several expression systems:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliCost-effective, high yieldLacks post-translational modifications, potential improper folding of transmembrane proteinsTruncated soluble domains, antibody production
Insect cellsBetter post-translational modifications, better folding of membrane proteinsModerate cost, more complex than bacterial systemsFull-length protein for structural studies
Mammalian cellsNative-like post-translational modificationsHigher cost, lower yieldFunctional assays, protein-protein interaction studies

For transmembrane proteins like tmem53, mammalian or insect cell expression systems typically provide better results than bacterial systems. Adding purification tags (His, FLAG, etc.) at either N- or C-terminus facilitates purification, but researchers should verify that tags don't interfere with protein function or localization .

How can tmem53 function be studied in the context of zebrafish disease models?

To investigate tmem53 in disease contexts, researchers should consider genetic interaction studies by combining tmem53 manipulation with established zebrafish disease models. For example:

  • Cross tmem53 mutants with tp53 M214K zebrafish, which develop malignant peripheral nerve sheath tumors , to study potential interactions in cancer development

  • Combine tmem53 knockdown with various oncogene-expressing zebrafish lines (e.g., expressing kras, xmrk, or myc under tissue-specific promoters)

  • Perform xenograft studies by transplanting human cancer cells into tmem53-modified zebrafish to assess effects on angiogenesis, extravasation, and metastasis

These approaches leverage zebrafish advantages for cancer research, including the ability to visualize processes like metastasis in real-time using fluorescently labeled cells .

What high-throughput screening approaches can identify small molecules affecting tmem53 function?

For identifying small molecules that modulate tmem53 function, researchers should:

  • Generate transgenic reporter lines expressing fluorescent proteins under tmem53-responsive promoters

  • Establish a phenotypic assay based on tmem53 knockdown/overexpression

  • Perform automated screening in 96-well format with compound libraries

  • Use automated image analysis to quantify phenotypic changes

This approach takes advantage of zebrafish's compatibility with high-throughput screening technologies and has been successfully applied for drug discovery in various disease contexts . For validation, researchers should confirm hits using secondary assays including dose-response curves and specificity testing.

How can zebrafish tmem53 be studied in relation to the tp53 tumor suppressor pathway?

Given the importance of tp53 in cancer biology and the availability of tp53 mutant zebrafish lines , researchers can:

  • Generate double-mutant lines by crossing tmem53 and tp53 mutants

  • Compare DNA damage responses between wild-type, single mutants, and double mutants using gamma radiation followed by TUNEL assays to measure apoptosis

  • Analyze cell cycle checkpoint activation by measuring p21 upregulation and BrdU incorporation

  • Perform long-term studies to monitor tumor development in single versus double mutants

The tp53 M214K mutant line, which develops malignant peripheral nerve sheath tumors starting at 8.5 months of age , provides an excellent background for studying potential oncogenic or tumor-suppressive functions of tmem53.

What are the key considerations when analyzing RNA-seq data for tmem53-related research?

When analyzing RNA-seq data for tmem53 studies, researchers should:

  • Include appropriate biological replicates (minimum n=3) for statistical power

  • Use proper normalization methods (e.g., TPM, FPKM) to account for gene length and sequencing depth

  • Apply differential expression analysis tools (DESeq2, edgeR) with appropriate false discovery rate correction

  • Perform Gene Ontology and pathway enrichment analysis on differentially expressed genes

  • Validate key findings using qRT-PCR on independent samples

For transmembrane proteins like tmem53, special attention should be paid to co-expressed genes involved in membrane trafficking, protein folding, and quality control pathways, as these may provide insights into protein function.

How should researchers approach conflicting data regarding tmem53 function in different experimental contexts?

When faced with conflicting data, researchers should:

  • Compare experimental conditions systematically, including:

    • Developmental stages examined

    • Genetic backgrounds of zebrafish lines

    • Specificity controls for knockdown/knockout approaches

    • Temperature conditions (as protein function can be temperature-sensitive, like tp53 N168K mutation)

  • Consider tissue-specific effects by using tissue-specific promoters for overexpression or conditional knockout systems

  • Validate findings across multiple experimental approaches:

    • Combine genetic (CRISPR, morpholino) and pharmacological approaches

    • Use rescue experiments with wild-type and mutant constructs

    • Apply complementary in vitro and in vivo methodologies

This systematic approach helps identify context-dependent functions and resolve apparent contradictions in experimental results.

What statistical approaches are most appropriate for analyzing phenotypic data in tmem53 zebrafish studies?

For rigorous statistical analysis of phenotypic data:

  • Determine appropriate sample sizes through power analysis before experiments

  • Use randomization and blinding when scoring phenotypes

  • Apply appropriate statistical tests based on data distribution:

    • Parametric tests (t-test, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions

  • Correct for multiple comparisons when analyzing multiple endpoints

  • Report effect sizes alongside p-values to convey biological significance

For survival analysis (e.g., in tumor studies), Kaplan-Meier analysis with log-rank tests should be employed to compare different genetic backgrounds. These approaches have been successfully used in zebrafish tp53 mutant cancer studies .

How can findings from zebrafish tmem53 research be effectively translated to human disease studies?

To maximize translational relevance:

  • Validate key findings in human cell lines expressing orthologs of zebrafish tmem53

  • Perform comparative genomics analysis to identify conserved regulatory elements

  • Analyze human patient data (e.g., from TCGA database) for alterations in TMEM53 expression or mutations

  • Consider genetic compensation responses in knockout models that may mask phenotypes

Zebrafish provide an excellent platform for initial drug discovery and mechanism studies, but findings must be validated in mammalian systems. Many zebrafish disease models have successfully contributed to clinical applications, such as the development of combinatorial therapy for rhabdomyosarcoma that advanced to phase I clinical trials .

What are the key considerations when designing a drug screening platform using tmem53 zebrafish models?

When designing drug screens targeting tmem53 function:

  • Develop robust readouts that reflect tmem53 activity:

    • Fluorescent reporters linked to downstream signaling

    • Quantifiable morphological phenotypes

    • Behavioral assays if relevant to protein function

  • Optimize screening conditions:

    • Determine optimal drug concentration ranges and exposure times

    • Standardize embryo staging and handling

    • Include positive and negative controls in each plate

  • Establish clear criteria for hit selection:

    • Define threshold values for significant effects

    • Include toxicity assessments

    • Plan secondary validation assays

This methodological approach leverages zebrafish's advantages for drug screening while ensuring results are robust and reproducible, following established practices in zebrafish-based drug discovery pipelines .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.