Recombinant Danio rerio Transmembrane protein 53 (Tmem53) is a protein derived from the zebrafish (Danio rerio), specifically produced using recombinant DNA technology . Tmem53 is also found in other organisms such as mice, rats, and humans . It is also known as transmembrane protein 53 .
Characteristics:
Source: Produced in vitro using an E. coli expression system .
Sequence: The protein consists of 281 amino acids with the following sequence: MGDDDLDYNIVFSEALISEKHWRGSKEPVVILLGWAGSRDKHLAKYSSIYNEQGCTTLRYTAPLKTVFISESLGYKELRSTAHKLLELLYDYEVENNPIFFHVFSNGGFMLYRYMVELLHSHKQFSTLCVVGTVVDSAPGSQNVVGALRALKTTLGPKVNVLLQYFLLALFAVAVFLLRIVLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMVESFD FITPAHVSLFRDCPEDYSNRCRTFLSHCMTTSEEILMKKHH .
Tmem53 is a transmembrane protein, meaning it spans the cell membrane . Mouse studies indicate that Tmem53 is abundantly expressed in tissues rich in highly ciliated cells, such as olfactory sensory neurons . In osteoblast lineage cells, Tmem53 negatively regulates bone morphogenetic protein (BMP) signaling by preventing the translocation of phosphorylated SMAD proteins from the cytoplasm to the nucleus .
Research indicates that deficiency in TMEM53 can lead to sclerosing bone disorders due to the dysregulation of BMP-SMAD signaling .
Key findings:
Individuals with homozygous TMEM53 pathogenic variants exhibit normal development until late-onset short stature .
Craniofacial dysmorphisms, such as a tall forehead and hypertelorism, are observed in both affected individuals and Tmem53 mutant mice .
TMEM53 deficiency promotes osteoblast differentiation by overactivating BMP signaling .
TMEM53 prevents the nuclear accumulation of SMAD1/5/9, which are essential for BMP signaling .
TMEM53 affects the BMP signaling pathway, which is critical for bone formation and development . TMEM53 appears to inhibit the activation of the SMAD-dependent BMP signaling pathway . Studies using TMEM53 knockout human cell lines showed that BMP signaling activity was upregulated in the absence of TMEM53 and downregulated when TMEM53 was overexpressed .
Experiments using Tmem53-deficient mice have provided further insights into the function of this protein . The mutant mice exhibited similar skeletal features to those observed in humans with TMEM53 pathogenic variants, including late-onset short stature, craniofacial dysmorphisms, and platyspondyly . The Tmem53 mutant mice also displayed thickening of the growth plate in the femur, suggesting that Tmem53 deficiency promotes chondrogenesis in the growth plate by overactivating BMP signaling .
Danio rerio tmem53 is a transmembrane protein belonging to the TMEM53 family with 281 amino acids and a molecular mass of approximately 32.5 kDa. The protein's complete amino acid sequence is:
MGDDDLDYNIVFSEALISEKHWRGSKEPVVILLGWAGSRDKHLAKYSSIYNEQGCTTLRYTAPLKTVFISESLGYKELRSTAHKLLELLYDYEVENNPIFFHVFSNGGFMLYRYMVELLHSHKQFSTLCVVGTVVDSAPGSQNVVGALRALKTTLGPKVNVLLQYFLLALFAVAVFLLRIVLYPLTKYFHRNHYDAMMEHPAPWPQMYLYSRADRVIRYRDVEKMVKGLQEKGLMVESFDFITPAHVSLFRDCPEDYSNRCRTFLSHCMTTSEEILMKKHH
When analyzing this protein structure, researchers should examine the transmembrane domains using prediction algorithms such as TMHMM or Phobius to identify membrane-spanning regions, which is critical for understanding protein topology and function in cellular membranes.
While the search results don't directly compare zebrafish tmem53 to human TMEM53, researchers should perform sequence alignment using tools like BLAST or Clustal Omega to determine sequence homology. Conservation analysis between species can reveal functionally important domains. Typically, transmembrane regions show higher conservation than loop regions, which can help identify critical functional domains for mutational studies. This comparative approach is essential when using zebrafish as a model for human disease research, as zebrafish and humans share many genetic pathways controlling signal transduction and development .
To determine expression patterns, researchers should perform whole-mount in situ hybridization (WISH) at various developmental stages using antisense RNA probes designed from the tmem53 sequence. Complementary approaches should include RT-qPCR for quantitative temporal expression and immunohistochemistry with anti-tmem53 antibodies for protein localization. Similar approaches have been used successfully to characterize expression patterns of other zebrafish genes like tp53 . Based on zebrafish developmental biology principles, monitoring expression in early embryogenesis (4-72 hours post-fertilization) is particularly informative for understanding potential roles in tissue differentiation and organogenesis.
For transient knockdown studies, antisense morpholino oligonucleotides (MOs) targeting the tmem53 translation start site or splice junctions can be microinjected into one-cell stage embryos. This approach has been successfully used in zebrafish to study other genes' functions, as demonstrated in MPS II pathogenesis studies . For more specific results, design at least two different MOs targeting different sites to confirm specificity of the phenotype.
For stable genetic knockout models, CRISPR/Cas9 offers a superior approach:
Design multiple sgRNAs targeting exons within tmem53's DNA-binding domain
Co-inject sgRNAs with Cas9 mRNA into one-cell stage embryos
Screen F0 founders for germline transmission using high-resolution melting analysis
Establish F1 heterozygote lines and intercross to obtain homozygous mutants
Similar genetic approaches have been effective for generating zebrafish tp53 mutant lines , which subsequently enabled significant cancer research advances.
Validation of antibodies for zebrafish tmem53 should follow a multi-step approach:
Western blot analysis comparing wild-type and tmem53 knockdown/knockout samples to verify specificity
Immunoprecipitation followed by mass spectrometry to confirm target binding
Immunofluorescence microscopy comparing wild-type and knockdown samples
Use of epitope-tagged recombinant tmem53 as a positive control
Researchers must be cautious about antibody cross-reactivity, particularly when using antibodies raised against mammalian orthologs. Expression of tagged tmem53 constructs can serve as controls for antibody validation experiments.
For functional studies requiring recombinant tmem53, researchers should consider several expression systems:
| Expression System | Advantages | Limitations | Optimal Applications |
|---|---|---|---|
| E. coli | Cost-effective, high yield | Lacks post-translational modifications, potential improper folding of transmembrane proteins | Truncated soluble domains, antibody production |
| Insect cells | Better post-translational modifications, better folding of membrane proteins | Moderate cost, more complex than bacterial systems | Full-length protein for structural studies |
| Mammalian cells | Native-like post-translational modifications | Higher cost, lower yield | Functional assays, protein-protein interaction studies |
For transmembrane proteins like tmem53, mammalian or insect cell expression systems typically provide better results than bacterial systems. Adding purification tags (His, FLAG, etc.) at either N- or C-terminus facilitates purification, but researchers should verify that tags don't interfere with protein function or localization .
To investigate tmem53 in disease contexts, researchers should consider genetic interaction studies by combining tmem53 manipulation with established zebrafish disease models. For example:
Cross tmem53 mutants with tp53 M214K zebrafish, which develop malignant peripheral nerve sheath tumors , to study potential interactions in cancer development
Combine tmem53 knockdown with various oncogene-expressing zebrafish lines (e.g., expressing kras, xmrk, or myc under tissue-specific promoters)
Perform xenograft studies by transplanting human cancer cells into tmem53-modified zebrafish to assess effects on angiogenesis, extravasation, and metastasis
These approaches leverage zebrafish advantages for cancer research, including the ability to visualize processes like metastasis in real-time using fluorescently labeled cells .
For identifying small molecules that modulate tmem53 function, researchers should:
Generate transgenic reporter lines expressing fluorescent proteins under tmem53-responsive promoters
Establish a phenotypic assay based on tmem53 knockdown/overexpression
Perform automated screening in 96-well format with compound libraries
Use automated image analysis to quantify phenotypic changes
This approach takes advantage of zebrafish's compatibility with high-throughput screening technologies and has been successfully applied for drug discovery in various disease contexts . For validation, researchers should confirm hits using secondary assays including dose-response curves and specificity testing.
Given the importance of tp53 in cancer biology and the availability of tp53 mutant zebrafish lines , researchers can:
Generate double-mutant lines by crossing tmem53 and tp53 mutants
Compare DNA damage responses between wild-type, single mutants, and double mutants using gamma radiation followed by TUNEL assays to measure apoptosis
Analyze cell cycle checkpoint activation by measuring p21 upregulation and BrdU incorporation
Perform long-term studies to monitor tumor development in single versus double mutants
The tp53 M214K mutant line, which develops malignant peripheral nerve sheath tumors starting at 8.5 months of age , provides an excellent background for studying potential oncogenic or tumor-suppressive functions of tmem53.
When analyzing RNA-seq data for tmem53 studies, researchers should:
Include appropriate biological replicates (minimum n=3) for statistical power
Use proper normalization methods (e.g., TPM, FPKM) to account for gene length and sequencing depth
Apply differential expression analysis tools (DESeq2, edgeR) with appropriate false discovery rate correction
Perform Gene Ontology and pathway enrichment analysis on differentially expressed genes
Validate key findings using qRT-PCR on independent samples
For transmembrane proteins like tmem53, special attention should be paid to co-expressed genes involved in membrane trafficking, protein folding, and quality control pathways, as these may provide insights into protein function.
When faced with conflicting data, researchers should:
Compare experimental conditions systematically, including:
Consider tissue-specific effects by using tissue-specific promoters for overexpression or conditional knockout systems
Validate findings across multiple experimental approaches:
Combine genetic (CRISPR, morpholino) and pharmacological approaches
Use rescue experiments with wild-type and mutant constructs
Apply complementary in vitro and in vivo methodologies
This systematic approach helps identify context-dependent functions and resolve apparent contradictions in experimental results.
For rigorous statistical analysis of phenotypic data:
Determine appropriate sample sizes through power analysis before experiments
Use randomization and blinding when scoring phenotypes
Apply appropriate statistical tests based on data distribution:
Parametric tests (t-test, ANOVA) for normally distributed data
Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions
Correct for multiple comparisons when analyzing multiple endpoints
Report effect sizes alongside p-values to convey biological significance
For survival analysis (e.g., in tumor studies), Kaplan-Meier analysis with log-rank tests should be employed to compare different genetic backgrounds. These approaches have been successfully used in zebrafish tp53 mutant cancer studies .
To maximize translational relevance:
Validate key findings in human cell lines expressing orthologs of zebrafish tmem53
Perform comparative genomics analysis to identify conserved regulatory elements
Analyze human patient data (e.g., from TCGA database) for alterations in TMEM53 expression or mutations
Consider genetic compensation responses in knockout models that may mask phenotypes
Zebrafish provide an excellent platform for initial drug discovery and mechanism studies, but findings must be validated in mammalian systems. Many zebrafish disease models have successfully contributed to clinical applications, such as the development of combinatorial therapy for rhabdomyosarcoma that advanced to phase I clinical trials .
When designing drug screens targeting tmem53 function:
Develop robust readouts that reflect tmem53 activity:
Fluorescent reporters linked to downstream signaling
Quantifiable morphological phenotypes
Behavioral assays if relevant to protein function
Optimize screening conditions:
Determine optimal drug concentration ranges and exposure times
Standardize embryo staging and handling
Include positive and negative controls in each plate
Establish clear criteria for hit selection:
Define threshold values for significant effects
Include toxicity assessments
Plan secondary validation assays
This methodological approach leverages zebrafish's advantages for drug screening while ensuring results are robust and reproducible, following established practices in zebrafish-based drug discovery pipelines .