Recombinant Danio rerio Transmembrane protein 93 (tmem93)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
emc6; tmem93; zgc:77320; ER membrane protein complex subunit 6; Transmembrane protein 93
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
emc6
Target Protein Sequence
MASVAAKREGPQFISEVSVRGNGAVLDYCRTSVSALSGATAGILGLTGLYGFVFYFLASF LLSLLLILKAGRRWNKCFKSRRLLFTGGLVGGLFTYVLFWTFLYGMVHVY
Uniprot No.

Target Background

Function
This protein is a component of the endoplasmic reticulum membrane protein complex (EMC). The EMC facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum membrane. It preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features, such as charged and aromatic residues. The EMC is involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. It's also crucial for the post-translational insertion of tail-anchored (TA) proteins into the ER membrane. By mediating the correct co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with a translocated N-terminus in the ER lumen), it controls the topology of multi-pass membrane proteins, such as G protein-coupled receptors. Through its regulation of protein membrane insertion, it indirectly influences numerous cellular processes.
Database Links
Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Danio rerio Transmembrane Protein 93 (tmem93) and what are its known functions?

Danio rerio Transmembrane Protein 93 (tmem93), also known as EMC6, is a conserved protein found in zebrafish that serves as an ER membrane complex subunit 6. It functions as an autophagy-related protein and has been implicated in processes like cellular homeostasis and stress response. EMC6/TMEM93 is encoded by a gene located on chromosome 17p13.2 in humans and is conserved across multiple species including cow, mouse, chicken, zebrafish, and xenopus . The protein has been shown to play a role in suppressing glioblastoma proliferation through autophagy activation mechanisms, suggesting its importance in cellular growth regulation .

How is recombinant Danio rerio tmem93 stored and reconstituted for experimental use?

For optimal stability, recombinant Danio rerio tmem93 should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles . The lyophilized protein powder is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

For reconstitution, researchers should:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • For short-term use, working aliquots can be stored at 4°C for up to one week

Note that repeated freezing and thawing is not recommended as it may compromise protein integrity.

What are the key considerations when designing experiments with recombinant Danio rerio tmem93?

When designing experiments with recombinant Danio rerio tmem93, researchers should consider:

  • Protein purity: The commercially available recombinant protein typically has >90% purity as determined by SDS-PAGE . Researchers should verify protein purity before experiments.

  • Expression system: The E. coli expression system used for recombinant production may affect post-translational modifications compared to native zebrafish protein.

  • Tag interference: The His-tag may affect protein function or interactions in some experimental settings, necessitating controls with tag-cleaved protein in critical experiments.

  • Buffer compatibility: Ensure experimental buffers are compatible with the protein's storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0).

  • Application-specific optimization: For techniques like Western blotting, immunofluorescence, or functional assays, optimization of protein concentration, antibody dilutions, and assay conditions is essential.

  • Relevant controls: Include appropriate positive and negative controls, especially when studying EMC6/TMEM93's role in autophagy pathways.

How can researchers effectively compare Danio rerio tmem93 function across different species?

To effectively compare tmem93 function across species, researchers should:

  • Perform sequence alignment analysis to identify conserved domains and motifs between Danio rerio tmem93 and its orthologs in other species.

  • Consider using homology modeling approaches similar to those used for other zebrafish transmembrane proteins to predict structural similarities and differences .

  • Design parallel experiments using recombinant proteins from multiple species under identical conditions.

  • Employ heterologous expression systems to express tmem93 from different species in the same cellular background.

  • Utilize knockout/knockdown models across species to assess functional conservation.

  • Examine the protein's role in conserved pathways such as autophagy regulation, which has been demonstrated for human EMC6/TMEM93 .

  • Apply complementation assays to determine if tmem93 from one species can rescue phenotypes in another species when the endogenous protein is depleted.

What techniques are recommended for studying tmem93 protein-protein interactions?

For studying tmem93 protein-protein interactions, the following methodologies are recommended:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down His-tagged recombinant tmem93 and identify binding partners.

  • Proximity labeling approaches: BioID or APEX2 fusions to tmem93 can identify proximal proteins in living cells.

  • Yeast two-hybrid screening: Using tmem93 as bait to screen for potential interactors, though membrane protein constraints must be considered.

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between purified tmem93 and candidate interacting proteins.

  • Crosslinking Mass Spectrometry (XL-MS): To capture transient or weak interactions within the native cellular environment.

  • Förster Resonance Energy Transfer (FRET): For studying interactions in living cells when fluorescently tagged versions of tmem93 and potential partners are co-expressed.

  • Mammalian two-hybrid systems: Particularly useful for membrane proteins like tmem93 when studying interactions in a cellular context.

When interpreting results, researchers should consider that the His-tag on recombinant tmem93 may affect some interactions and validation with alternative tagging strategies or tag-free protein may be necessary.

How can researchers effectively study the role of tmem93/EMC6 in autophagy regulation?

Given that EMC6/TMEM93 has been implicated in autophagy regulation , researchers can employ the following approaches:

  • LC3B-II monitoring: Measure LC3B-II levels by Western blot in cells with modulated tmem93 expression, as EMC6 overexpression has been shown to elevate LC3B-II levels .

  • Autophagic flux assays: Use lysosomal inhibitors (e.g., Bafilomycin A1, Chloroquine) in combination with tmem93 overexpression or knockdown to distinguish between autophagy induction and blockade.

  • Fluorescent reporter systems: Utilize GFP-LC3 or tandem fluorescent-tagged LC3 (tfLC3) to visualize autophagosome formation and maturation in response to tmem93 manipulation.

  • Electron microscopy: For ultrastructural analysis of autophagic compartments in cells with altered tmem93 levels.

  • Selective autophagy substrate degradation: Monitor degradation of specific autophagy substrates (e.g., p62/SQSTM1) in response to tmem93 modulation.

  • Autophagy signaling pathway analysis: Examine the status of upstream regulators like mTOR, AMPK, or ULK1 to determine how tmem93 interfaces with established autophagy regulatory pathways.

  • Drug combination studies: As demonstrated with TMZ in glioblastoma cells, combining tmem93 modulation with autophagy-inducing drugs can reveal synergistic effects and mechanistic insights .

What are the key considerations when analyzing SDS-PAGE results for recombinant tmem93?

When analyzing SDS-PAGE results for recombinant tmem93, researchers should consider:

  • Expected molecular weight: The full-length protein (110 amino acids) plus the His-tag should migrate at approximately 12-14 kDa, though the exact migration pattern may be influenced by the protein's hydrophobic nature.

  • Purity assessment: Commercial preparations typically show >90% purity by SDS-PAGE . Multiple bands may indicate degradation, aggregation, or contamination.

  • Transmembrane protein behavior: Membrane proteins like tmem93 may exhibit anomalous migration patterns due to incomplete denaturation or detergent binding.

  • Sample preparation effects: Heat-induced aggregation is common with membrane proteins; compare boiled versus non-boiled samples.

  • Staining sensitivity: For low concentration analysis, silver staining offers greater sensitivity than Coomassie.

  • Validation techniques: Consider complementing SDS-PAGE with Western blotting using anti-His or anti-tmem93 antibodies for specific detection.

  • Quantification approach: For comparative studies, densitometry analysis should include appropriate loading controls and standards.

How should researchers address experimental variability when working with recombinant tmem93?

To address experimental variability when working with recombinant tmem93, researchers should:

  • Standardize protein handling:

    • Use consistent reconstitution protocols

    • Prepare single-use aliquots to avoid freeze-thaw cycles

    • Monitor protein stability over time and storage conditions

  • Implement quality control measures:

    • Verify protein concentration using multiple methods (e.g., Bradford, BCA)

    • Confirm activity/integrity before critical experiments

    • Document lot-to-lot variation when using commercial sources

  • Optimize experimental conditions:

    • Determine optimal buffer conditions for specific applications

    • Test different protein concentrations to establish dose-response relationships

    • Consider the impact of the His-tag on experimental outcomes

  • Apply robust statistical approaches:

    • Use sufficient biological and technical replicates

    • Apply appropriate statistical tests based on data distribution

    • Consider power analysis for sample size determination

  • Control for confounding factors:

    • Account for cell type-specific effects when studying tmem93 function

    • Consider the impact of cellular stress on autophagy-related experiments

    • Include appropriate positive and negative controls in each experiment

How can zebrafish tmem93/EMC6 research inform therapeutic approaches for human diseases?

Research on zebrafish tmem93/EMC6 could inform therapeutic approaches for human diseases through several avenues:

  • Cancer research applications: Studies have shown that EMC6/TMEM93 can suppress glioblastoma proliferation by modulating autophagy . Understanding the mechanisms in zebrafish models could inform novel therapeutic strategies for human cancers.

  • Evolutionary conservation insights: Given that EMC6/TMEM93 is conserved across species including zebrafish and humans , functional studies in zebrafish can provide translatable insights into human biology.

  • Drug screening platform: Zebrafish models expressing fluorescently tagged tmem93 could be used for high-throughput screening of compounds that modulate its expression or function.

  • Autophagy modulation: As tmem93/EMC6 plays a role in autophagy regulation, it represents a potential target for diseases where autophagy is dysregulated, including neurodegenerative disorders, infectious diseases, and metabolic disorders.

  • Structure-based drug design: Detailed structural information about zebrafish tmem93, potentially obtained through methods similar to those used for other zebrafish proteins , could guide the design of small molecules targeting human EMC6.

  • Combination therapy development: The synergistic effect observed between EMC6 overexpression and TMZ treatment in glioblastoma suggests potential for combination therapies targeting EMC6-related pathways alongside conventional treatments.

What are emerging techniques for studying transmembrane proteins like tmem93 that researchers should consider adopting?

Emerging techniques for studying transmembrane proteins like tmem93 include:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of membrane protein structures without crystallization, particularly valuable for proteins like tmem93 that may be difficult to crystallize.

  • AlphaFold and related AI approaches: Computational structure prediction has advanced significantly and can provide structural insights when experimental structures are unavailable.

  • Nanodiscs and SMALPs: These technologies provide more native-like membrane environments for functional studies compared to detergent solubilization.

  • Genome editing in model systems: CRISPR/Cas9-based approaches in zebrafish allow precise genetic manipulation to study tmem93 function in vivo.

  • Single-molecule techniques: Methods like single-molecule FRET or atomic force microscopy can reveal dynamic aspects of transmembrane protein function.

  • Molecular dynamics simulations: Similar to those performed for other zebrafish proteins , can provide insights into tmem93 behavior in membranes and conformational changes.

  • Spatially resolved transcriptomics and proteomics: These approaches can reveal tissue-specific expression patterns and interactomes of tmem93 in zebrafish.

  • Optogenetic tools: Light-controlled manipulation of tmem93 function could enable precise temporal control in functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.