Recombinant Danio rerio Transmembrane protein FAM155A (fam155a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes if needed. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fam155b; si:dkey-48f17.1; zgc:158322; Transmembrane protein FAM155B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
fam155a
Target Protein Sequence
MITGAWRCGRKLDAELEICRVTEPIDKPCAESEKVQRWRMSLASLLFFTALLSDHLWLCA GGKLRSRDRTHRRTWNNASHDAQTGLRDEDCGVLLSNLTENGPDCVEADARRRAPLESAC STLYRQKSGSVSSSYSVTVPTVSPHAFLEYFRNFSLSFCDALTIADLLESMTSPDGLNCS LTHIIRDLFSGGPEDGDACSACVHAYTRLDQHAQEKYEEFDALTRKYMADDYSVRAQTHL CQVVYKAWLCAEYFPVPQRQCVRWLPCRHYCGEVTATCPFILPDNDRLLYAGSPSFLCAG FQEEYLSSQGPDCCDVRWSGCDSAVGAACALTHLPGSFSFHRRLSSGAMSCTNRLHGSKL KLCVLVLFLLHTFISITTLQHCSTGSLEAIVPLEEVPMREE
Uniprot No.

Target Background

Database Links
Protein Families
FAM155 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM155A and what is its basic structure?

FAM155A (family with sequence similarity 155, member A) is a transmembrane protein with glycosylation. Human FAM155A consists of 458 amino acids with a calculated molecular weight of 51 kDa, though the observed molecular weight typically ranges from 49-55 kDa . The protein is encoded by a gene that spans 703 kb with only three exons, and no other protein coding genes lie within 500 kb of common variants like rs67153654-A . In terms of amino acid composition, FAM155A contains notably high percentages of leucine (10.0%), serine (9.4%), and glutamine (8.1%) .

What is the cellular localization and expression pattern of FAM155A?

FAM155A is primarily expressed in the hypothalamus and pituitary gland, with lower expression observed in the colon and blood . As a transmembrane protein, FAM155A integrates into cellular membranes where it can interact with other membrane proteins. Notably, FAM155A forms extensive interactions with the extracellular loops of NALCN (sodium leak channel), helping to stabilize NALCN in the membrane . These interaction patterns suggest FAM155A may play important roles in stabilizing membrane protein complexes.

How conserved is FAM155A across species and what is its relationship to other proteins?

FAM155A shows some degree of conservation across vertebrates, with homologs identified in various species including zebrafish (Danio rerio). The closest human paralog is FAM155B, which shows approximately 24.6% sequence similarity . Other less similar human proteins include transmembrane protein 28 and various transcription factors. This moderate conservation suggests functional importance while allowing for species-specific adaptations.

Why is Danio rerio (zebrafish) used as a model for studying FAM155A?

Zebrafish (Danio rerio) represents an excellent model organism for studying FAM155A due to several advantages. Zebrafish embryos develop externally and are transparent, allowing for direct observation of developmental processes. Their genome is fully sequenced and shows significant homology to human genes, including conservation of many disease-associated genes. Additionally, zebrafish embryos are widely accepted as an alternative model for toxicity testing and are used in whole effluent toxicity testing in North America and European countries . For FAM155A specifically, the zebrafish model allows researchers to examine protein function in the context of a whole vertebrate system.

How does Danio rerio FAM155A compare structurally and functionally to human FAM155A?

While the search results don't provide detailed comparison data between human and zebrafish FAM155A, researchers should consider that zebrafish orthologs typically share core functional domains with human proteins while potentially differing in regulatory regions. When working with recombinant Danio rerio FAM155A, it's important to assess conservation of key functional domains, post-translational modification sites, and interaction interfaces. Phylogenetic analysis and sequence alignment tools should be employed to identify highly conserved regions that likely maintain similar functions across species.

What developmental stages of zebrafish are optimal for studying FAM155A expression and function?

Based on experimental protocols using zebrafish embryos, researchers typically employ early developmental stages (0-72 hours post-fertilization) for studying protein expression and function . For FAM155A specifically, considering its expression in neural tissues in humans (hypothalamus and pituitary), researchers should examine expression during key stages of nervous system development in zebrafish. Time-course studies examining FAM155A expression through embryonic and larval stages would help establish the developmental timeline of FAM155A function.

What methods are recommended for detecting FAM155A expression in tissue samples?

For detecting FAM155A in tissue samples, immunohistochemistry (IHC) has been validated using specific antibodies. Published protocols recommend using TE buffer pH 9.0 for antigen retrieval, although citrate buffer pH 6.0 can serve as an alternative . For Western blot applications, dilutions of 1:200-1:1000 are recommended, while IHC applications typically use dilutions of 1:20-1:200 . When working with zebrafish samples, researchers should validate antibody cross-reactivity or develop zebrafish-specific antibodies. RNA-sequencing represents another approach for examining FAM155A expression patterns across tissues .

How can recombinant FAM155A be effectively produced and purified for functional studies?

While the search results don't provide detailed purification protocols for recombinant Danio rerio FAM155A, general approaches for transmembrane protein production should be considered. Researchers typically use eukaryotic expression systems (like insect cells or mammalian cells) rather than bacterial systems for transmembrane proteins to ensure proper folding and post-translational modifications. Purification often involves detergent solubilization followed by affinity chromatography using tags such as His-tag or FLAG-tag. For functional studies, consideration should be given to maintaining the native conformation during purification, possibly through the use of nanodiscs or other membrane mimetics.

What are the key considerations for designing CRISPR/Cas9 knockout or knockdown studies of FAM155A in zebrafish?

When designing CRISPR/Cas9 experiments for FAM155A in zebrafish, researchers should consider several factors:

  • Target selection: Design guide RNAs targeting early exons or critical functional domains to maximize disruption

  • Off-target effects: Thoroughly screen guide RNA designs for potential off-target sites

  • Mosaicism: Account for potential mosaicism in F0 fish and plan breeding to establish stable lines

  • Phenotype validation: Verify knockout at both DNA (sequencing) and protein levels (Western blot/immunostaining)

  • Rescue experiments: Include rescue experiments with wild-type FAM155A to confirm phenotype specificity

  • Control for potential compensatory mechanisms: Consider monitoring related family members like FAM155B

What is known about FAM155A's role in NALCN channelosome function and related disorders?

FAM155A forms extensive interactions with the extracellular loops of NALCN (sodium leak channel) that help stabilize NALCN in the membrane . NALCN is responsible for resting Na+ permeability that controls neuronal excitability, and dysfunctions of the NALCN channelosome are associated with various human diseases . The cryo-EM structure of human NALCN in complex with FAM155A reveals that FAM155A likely plays a critical role in stabilizing NALCN conformations. This interaction suggests FAM155A could be implicated in channelopathies related to NALCN dysfunction, particularly those affecting the central nervous system where NALCN is predominantly expressed.

How does FAM155A relate to diverticular disease and diverticulitis?

Genetic studies have identified a significant association between a variant in FAM155A (rs67153654-A) and reduced risk of diverticulitis . This variant shows a protective effect with an odds ratio of 0.80 (95% CI: 0.74, 0.87) in Icelandic populations and 0.84 (95% CI: 0.78, 0.91) in Danish populations . Interestingly, the variant is significantly less frequent in diverticulitis compared to uncomplicated diverticular disease (OR=0.84, 95% CI: 0.74, 0.94, P=3.8×10−3), suggesting a specific protective effect against the inflammatory complication rather than the development of diverticula themselves . The mechanism behind this association remains unclear, as the variant does not appear to affect FAM155A expression in available datasets .

What other potential disease associations have been reported for FAM155A?

In addition to diverticular disease, FAM155A variants have been potentially linked to metabolic and neuropsychiatric conditions. SNPs near the FAM155A locus (though with low linkage disequilibrium with rs67153654-A, r²<0.01) have been associated with increased fat mass in children and anorexia nervosa . Given FAM155A's expression in the hypothalamus and pituitary gland, these associations suggest possible roles in neuroendocrine pathways that regulate metabolism and behavior. Further research is needed to establish causal relationships and mechanisms.

What protein-protein interaction studies are recommended for understanding FAM155A function?

To elucidate FAM155A function, researchers should consider several protein-protein interaction approaches:

  • Co-immunoprecipitation: Particularly useful for identifying native interaction partners

  • Proximity labeling: BioID or APEX2 fusion proteins can identify proximal proteins in living cells

  • Cryo-EM analysis: As successfully employed for the NALCN-FAM155A complex

  • Yeast two-hybrid screening: For identifying potential novel interaction partners

  • FRET/BRET assays: For examining dynamic interactions in living cells

For the NALCN-FAM155A interaction specifically, structural studies have shown that FAM155A forms extensive interactions with the extracellular loops of NALCN that help stabilize NALCN in the membrane . Similar approaches could reveal other potential membrane protein partners.

What are the challenges in interpreting FAM155A genetic variant data from population studies?

Interpreting FAM155A genetic variant data presents several challenges:

  • Functional impact assessment: The 16 missense variants found in FAM155A don't show associations with diverticular disease or diverticulitis , suggesting functional impact may be through non-coding mechanisms

  • Expression effects: The protective variant rs67153654-A shows no detectable effect on FAM155A expression in available tissues

  • Tissue specificity: As FAM155A is mainly expressed in brain regions with low expression in other tissues, relevant expression effects might be missed in accessible tissues

  • Biological context: Understanding how FAM155A variants influence disease requires considering its role in protein complexes like the NALCN channelosome

A comprehensive approach combining population genetics, functional genomics, and protein interaction studies is needed to fully interpret variant effects.

How can zebrafish embryo toxicity assays be adapted for studying FAM155A function?

Zebrafish embryo toxicity assays can be adapted to study FAM155A function through several approaches:

  • FAM155A knockdown/knockout: Using CRISPR/Cas9 or morpholinos followed by standardized developmental and behavioral assessments

  • Overexpression studies: Injecting wild-type or mutant FAM155A mRNA to assess gain-of-function effects

  • Chemical genetics: Screening compound libraries for molecules that modify FAM155A-associated phenotypes

  • Tissue-specific manipulation: Using tissue-specific promoters to manipulate FAM155A in relevant cell types

  • Electrophysiological assessment: Given FAM155A's role with NALCN, measuring neuronal activity parameters

The standardized protocols used for zebrafish embryo toxicity testing provide a framework for quantitative phenotypic assessment , including monitoring of survival rates, developmental milestones, and morphological abnormalities.

How might single-cell analysis techniques advance our understanding of FAM155A function?

Single-cell technologies offer powerful approaches for understanding FAM155A function in complex tissues:

  • Single-cell RNA-seq: Can reveal cell type-specific expression patterns of FAM155A, particularly important given its expression in specific brain regions

  • Spatial transcriptomics: Allows mapping of FAM155A expression within tissue architecture

  • Single-cell ATAC-seq: Can identify cell type-specific regulatory elements controlling FAM155A expression

  • CyTOF/single-cell proteomics: Can examine co-expression of FAM155A with other proteins at single-cell resolution

  • Patch-seq: Combines electrophysiology with transcriptomics, particularly relevant for studying FAM155A's role with ion channels

These approaches could help resolve how FAM155A functions in specific cell types and developmental contexts that might be missed in bulk tissue analyses.

What are the implications of FAM155A's structure for drug discovery targeting the NALCN channelosome?

The structural data showing FAM155A forms extensive interactions with NALCN's extracellular loops has significant implications for drug discovery:

  • Novel binding sites: The interface between FAM155A and NALCN may contain druggable pockets

  • Stabilization strategies: Compounds that enhance FAM155A-NALCN interaction could stabilize channel function

  • Selectivity potential: The auxiliary subunit interface may offer greater selectivity than targeting the highly conserved channel pore

  • Structure-based design: The cryo-EM structure at 3.1 angstrom resolution provides a foundation for rational drug design

  • Allosteric modulation: FAM155A binding sites might allow for allosteric modulation of NALCN function

This structural understanding opens new therapeutic avenues for conditions associated with NALCN dysfunction.

What comparative genomics approaches might reveal about FAM155A evolution and function?

Comparative genomics analyses could provide valuable insights into FAM155A:

  • Evolutionary rate analysis: Identifying rapidly or slowly evolving domains within FAM155A

  • Synteny analysis: Examining conservation of genomic context around FAM155A across species

  • Paralog comparison: Detailed comparison with FAM155B to identify shared vs. specialized functions

  • Positive selection scanning: Identifying sites under positive selection pressure that might indicate functional specialization

  • Regulatory element conservation: Comparing non-coding regulatory elements across species to identify critical control regions

Such analyses could reveal functional constraints on FAM155A and identify regions critical for its conserved functions versus those that might mediate species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.