Recombinant Danio rerio Trimeric intracellular cation channel type B (tmem38b)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Danio rerio TMEM38B is a full-length, His-tagged protein expressed in E. coli, with the following specifications:

PropertyDetails
UniProt IDQ7ZVP8
Amino Acid Sequence289 residues (MDVFAFFNLNELAFGLSKLPMFPYFDMAHYIISVMSLREQPGALCVSQRSPLACWFSSML...TN)
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in sterile water (0.1–1.0 mg/mL) with glycerol

The protein corresponds to residues 1–289 of zebrafish TMEM38B, retaining functional domains critical for cation channel activity .

Osteogenesis Imperfecta (OI)

Null mutations in TMEM38B disrupt ER calcium kinetics, leading to:

  • Collagen Dysregulation: Impaired procollagen chain assembly, reduced lysine hydroxylation, and ER stress due to altered Ca²⁺ flux .

  • Bone Fragility: Zebrafish tmem38b mutants exhibit skeletal deformities and reduced osteoblast/osteoclast activity, mirroring human OI phenotypes .

Cellular Mechanisms

  • ER Calcium Flux: TRIC-B deficiency slows ER Ca²⁺ depletion and recovery, disrupting collagen post-translational modifications (e.g., hydroxylation) .

  • Chaperone Dysfunction: Altered interactions with collagen-specific chaperones (BiP, PDI) and enzymes (FKBP65, CyPB) exacerbate protein misfolding .

Research Applications

This recombinant protein is utilized in:

  1. In Vitro Calcium Imaging: Studying ER Ca²⁺ release kinetics using reconstituted TRIC-B in lipid bilayers .

  2. Disease Modeling: Generating zebrafish mutants (tmem38b −/−) to investigate OI pathophysiology and screen therapeutics .

  3. Structural Studies: Analyzing ion channel gating mechanisms via mutagenesis (e.g., pore domain variants) .

Expression and Purification

  • Vector Design: Full-length tmem38b cloned with N-terminal His tag for affinity chromatography .

  • Yield: Typical yields range from 0.5–1.0 mg/L culture, with endotoxin levels <1.0 EU/μg .

Stability Considerations

  • Reconstitution: Requires glycerol (5–50%) for long-term storage at -80°C; avoid freeze-thaw cycles .

  • Activity Assays: Channel function validated using planar lipid bilayer electrophysiology .

Recent Research Findings

StudyKey Insight
CRISPR Zebrafish Model (2023)tmem38b −/− mutants show defective caudal fin regeneration and osteoblast dysfunction .
Novel Splice Variant (2023)c.660+1G>A in TMEM38B linked to severe OI via aberrant mRNA splicing .
ER Calcium Dynamics (2016)TRIC-B loss reduces SOCE (store-operated calcium entry), impairing collagen secretion .

Comparative Analysis with Orthologs

SpeciesProteinIdentityFunctional Overlap
HumanTMEM38B (TRIC-B)72%ER calcium homeostasis; OI pathogenesis .
MouseTmem38b70%Perinatal lethality due to surfactant defects .
RatTmem38b75%Hepatic calcium signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem38b; zgc:55815; Trimeric intracellular cation channel type B; TRIC-B; TRICB; Transmembrane protein 38B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem38b
Target Protein Sequence
MDVFAFFNLNELAFGLSKLPMFPYFDMAHYIISVMSLREQPGALCVSQRSPLACWFSSML YCFGGAVLSALMLADAPVAPLSNTTNLLLATLMWYLVFYCPLDVVYSLASLLPLRLVLTA MKEVTRTWKVLSGVSQAGSKYSDALFVMVAVGWAKGAGGGLISNFEQLVRGVWKPETNEL LKMSYPTKVTLLGAVVFSLQQCRYLPIQTHHLTFIYTLFTVTNKTRMMLLGSSSHPLSSL ESFLYKTLFVRPLTDLSAEHTHSKHNGSVPEPTTAQTHTKEAEASKKTN
Uniprot No.

Target Background

Function
This monovalent cation channel is crucial for maintaining rapid intracellular calcium release. It may function as a potassium counter-ion channel, working in coordination with calcium release from intracellular stores.
Database Links

KEGG: dre:393145

UniGene: Dr.82370

Protein Families
TMEM38 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is tmem38b and what is its function in zebrafish?

Tmem38b (Transmembrane protein 38B) encodes Trimeric Intracellular Cation Channel Type B (TRIC-B), which is an endoplasmic reticulum (ER) integral membrane protein. This protein is involved in the regulation of calcium release mediated primarily by inositol 1,4,5-trisphosphate (IP3Rs) receptors . In zebrafish, tmem38b is expressed at early developmental stages and has maternal expression, indicating its importance during embryonic development . The primary function of TRIC-B is to regulate calcium flux from the ER to the cytosol, which is critical for proper cell homeostasis and function .

How does zebrafish tmem38b compare structurally to human TMEM38B?

Zebrafish tmem38b encodes a 289-amino acid protein that shares significant structural conservation with human TMEM38B . Both proteins contain highly conserved domains essential for their function as cation channels. The full-length Danio rerio trimeric intracellular cation channel type B (tmem38b) protein has conserved transmembrane domains that form the channel pore . Comparative analysis between human and zebrafish TRIC-B shows conservation of key functional domains, including the KEV domain which, when deleted in zebrafish models, results in functional impairment .

What expression patterns does tmem38b show during zebrafish development?

Studies have demonstrated that tmem38b is expressed from early developmental stages in zebrafish. Notably, tmem38b exhibits maternal expression, unlike tmem38a (which encodes Tric-a) . In situ hybridization experiments using an 841 bp amplicon obtained by RT-PCR amplification show expression patterns throughout early developmental stages . Quantitative PCR using commercial TaqMan probes has been used to track expression levels at different developmental timepoints, showing that tmem38b is expressed in multiple tissues during zebrafish development .

How are zebrafish tmem38b mutants generated for research purposes?

Zebrafish tmem38b mutants have been successfully generated using CRISPR/Cas9 genome editing technology. Two specific types of mutants have been reported in the literature:

  • Out-of-frame mutation model: This mutant carries a mutation that introduces a premature stop codon in the tmem38b gene .

  • In-frame deletion model: This mutant (tmem38bΔ120-7/Δ120-7) has an in-frame deletion that removes the highly conserved KEV domain of the protein .

The generation process typically involves designing guide RNAs targeting specific regions of the tmem38b gene, followed by microinjection of CRISPR/Cas9 components into one-cell stage zebrafish embryos. Successful mutants are identified through genotyping and subsequently propagated to establish stable lines for experimental use .

What methods are used to study calcium signaling in tmem38b mutant zebrafish models?

Calcium signaling studies in tmem38b mutant zebrafish typically employ a combination of the following methodologies:

  • Calcium imaging techniques using fluorescent calcium indicators to visualize real-time calcium flux in live cells or tissues.

  • Electrophysiological approaches to measure channel activity and calcium currents.

  • Molecular assays to assess the expression and activity of calcium-dependent enzymes and pathways affected by tmem38b deficiency.

  • Histological and immunohistochemical analyses to evaluate tissue-specific effects of altered calcium homeostasis, particularly in bone cells where calcification processes are dependent on proper calcium regulation .

These techniques collectively help researchers understand how tmem38b deficiency affects calcium release from the ER and subsequent downstream cellular processes .

What are the optimal conditions for reconstituting recombinant zebrafish tmem38b protein?

For optimal reconstitution of recombinant zebrafish tmem38b protein:

  • Centrifuge the vial containing lyophilized protein briefly to bring contents to the bottom before opening.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enhance stability for long-term storage.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term storage, or at 4°C for up to one week if in active use .

The recombinant protein is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and subsequent applications .

How does tmem38b deficiency affect skeletal development in zebrafish models?

Tmem38b deficiency in zebrafish results in specific skeletal phenotypes that vary in severity depending on the type of mutation. The following key effects have been observed:

  • In the tmem38bΔ120-7/Δ120-7 mutant (in-frame deletion of the KEV domain):

    • Mild skeletal phenotype at late larval and juvenile stages of development

    • Altered bone mineralization and morphology

    • Impaired caudal fin regeneration capabilities

  • In the tmem38b-/- mutant (out-of-frame mutation):

    • More limited bone phenotype primarily characterized by reduced vertebral length at 21 days post-fertilization (dpf)

    • Altered collagen processing similar to human OI type XIV

Both models show collagen type I that is under-modified and partially retained in the endoplasmic reticulum, mirroring what is observed in human patients with OI type XIV . Quantitative measurements at different developmental stages (21 dpf, 1 month post-fertilization, and 2 months post-fertilization) show progressive manifestation of skeletal abnormalities .

What methods are most effective for analyzing bone mineralization defects in tmem38b mutant zebrafish?

Several complementary methods have proven effective for analyzing bone mineralization defects in tmem38b mutant zebrafish:

  • Microscopic imaging: Using a stereomicroscope (e.g., M165FC) connected to a digital camera for whole-mount imaging of skeletal structures .

  • Morphometric analysis: Measuring standard length (SL), vertebral length, and vertebral height at different developmental stages (21 dpf, 1 mpf, 2 mpf) using specialized software like LAS v4.13 .

  • Histological staining: Using bone-specific stains such as Alizarin Red for calcified matrix and Alcian Blue for cartilage to visualize mineralization patterns.

  • Caudal fin regeneration assay: This technique has been particularly informative for studying both osteoblast and osteoclast activity in the context of tmem38b deficiency .

  • Molecular analysis: RT-qPCR to measure expression of bone-related genes in mutant versus wild-type fish, using appropriate reference genes such as rpl13a and β-actin .

How does the zebrafish tmem38b mutant phenotype compare to human Osteogenesis Imperfecta Type XIV?

The zebrafish tmem38b mutant phenotype shows several important similarities and some differences compared to human Osteogenesis Imperfecta Type XIV:

FeatureZebrafish tmem38b MutantsHuman OI Type XIV
Collagen processingUnder-modified collagen type I with partial ER retentionUnder-modified collagen type I with partial ER retention
Fracture susceptibilityNot prominently reportedRecurrent fractures
Bone massReduced mineralizationLow bone mass
GrowthReduced vertebral lengthGrowth retardation
Skeletal deformitiesMild skeletal phenotypeMild to severe bone deformities
Hearing lossNot reportedVariable presence
Dentinogenesis imperfectaNot reportedAbsent in some cohorts, variable in others
Cellular phenotypeImpaired osteoblast and osteoclast activityImpaired osteoblast differentiation with reduced expression of early markers (RUNX2, SP7)

The zebrafish models recapitulate the fundamental molecular and cellular defects seen in human patients, particularly regarding collagen processing and bone cell function, making them valuable research tools .

What is the molecular mechanism by which tmem38b deficiency affects collagen processing?

The molecular mechanism linking tmem38b deficiency to collagen processing abnormalities involves several interconnected steps:

  • TRIC-B deficiency leads to dysregulation of calcium flux from the ER to the cytosol .

  • This calcium dysregulation impacts the activity of multiple collagen-specific chaperones and modifying enzymes that require optimal calcium concentrations for proper function .

  • As a result, collagen type I becomes under-modified and is partially retained within the ER .

  • The retained collagen causes ER stress and increased degradation of collagen molecules .

  • Abnormally secreted collagen molecules that escape the ER are not properly incorporated into extracellular matrix fibers .

This mechanism explains why tmem38b mutant zebrafish display collagen abnormalities similar to those seen in human OI type XIV patients, despite the primary defect being in a calcium channel rather than in collagen itself .

How does calcium signaling disruption in tmem38b mutants affect osteoblast and osteoclast function?

Calcium signaling disruption in tmem38b mutants affects bone cells in several specific ways:

  • Effects on osteoblasts:

    • Reduced mineralization capacity as demonstrated in fin regeneration studies

    • Altered differentiation pathway, potentially similar to human OI type XIV osteoblasts which show reduced expression of early differentiation markers (RUNX2, SP7) and increased expression of later markers that inhibit crystal growth

    • Possible impairment in proliferation, as observed in human cell models with TMEM38B knockout

  • Effects on osteoclasts:

    • Reduced number and activity of osteoclasts

    • Impaired remodeling during bone regeneration

The caudal fin regeneration model in zebrafish has been particularly useful for demonstrating these effects, as it allows for the assessment of both bone-forming and bone-resorbing cell populations in a controlled regenerative environment .

What interactions exist between tmem38b and other calcium regulatory proteins in the endoplasmic reticulum?

Tmem38b (TRIC-B) functions within a complex network of calcium regulatory proteins in the endoplasmic reticulum:

  • TRIC-B operates in coordination with inositol 1,4,5-trisphosphate receptors (IP3Rs), which are the primary calcium release channels affected by TRIC-B function .

  • TRIC-B may functionally interact with ryanodine receptors (RyRs) in certain tissues, though its primary association is with IP3Rs .

  • In muscle cells, TRIC channels (including TRIC-B) can act together with junctophilin proteins to support efficient RyR-mediated calcium release .

  • The loss of both TMEM38A and TMEM38B in mouse models leads to severe dysfunction in SR calcium handling and reduced potassium permeability, suggesting these channels work together as counter-ion channels that function in synchronization with calcium release mechanisms .

Research suggests that TRIC-B may be part of a larger macromolecular complex in the ER membrane that coordinates calcium homeostasis, though the complete interaction network remains to be fully elucidated .

How can zebrafish tmem38b models be used to test potential therapeutics for Osteogenesis Imperfecta Type XIV?

Zebrafish tmem38b models offer several advantages for testing potential therapeutics for OI Type XIV:

  • High-throughput screening capabilities:

    • The transparency of zebrafish larvae allows for in vivo imaging of skeletal elements

    • Large numbers of embryos can be treated simultaneously with different compounds

    • Automated phenotyping can be used to assess drug efficacy

  • Specific therapeutic readouts:

    • Improvements in collagen processing can be assessed through biochemical and imaging techniques

    • Bone mineralization can be quantified using standard length and vertebral measurements

    • Caudal fin regeneration assays can measure improvements in osteoblast and osteoclast function

  • Potential therapeutic approaches to test:

    • Calcium channel modulators that might compensate for TRIC-B deficiency

    • Compounds that enhance collagen folding and processing

    • Agents that reduce ER stress caused by retained collagen

    • Bone anabolic treatments that might bypass the tmem38b-dependent pathways

The combination of genetic specificity, ease of manipulation, and reliable phenotypic readouts makes zebrafish tmem38b models valuable for preclinical therapeutic development .

What are the challenges in correlating zebrafish tmem38b phenotypes to human TMEM38B-related disease manifestations?

Several challenges exist when correlating zebrafish tmem38b phenotypes to human TMEM38B-related diseases:

  • Phenotypic spectrum differences:

    • Zebrafish tmem38b mutants show relatively mild skeletal phenotypes compared to the variable but sometimes severe presentation in humans

    • The absence of spontaneous fractures in zebrafish models versus their presence in human patients

  • Physiological differences:

    • Differences in bone development, structure, and loading between teleost fish and humans

    • Aquatic versus terrestrial environments create different biomechanical forces on the skeleton

  • Temporal considerations:

    • The relatively short lifespan of zebrafish versus humans affects the manifestation of chronic progressive conditions

    • Developmental timing differences can complicate stage-specific comparisons

  • Respiratory system involvement:

    • Mouse Tmem38b knockout models die shortly after birth due to respiratory failure

    • Human patients with TMEM38B mutations do not typically present with respiratory failure

    • Zebrafish tmem38b mutants do not show reported respiratory issues

Despite these challenges, zebrafish models still provide valuable insights into the fundamental molecular and cellular mechanisms underlying TMEM38B-related disorders, particularly regarding collagen processing defects .

How might CRISPR/Cas9 knock-in strategies be optimized to create precise disease-relevant tmem38b mutations?

Optimizing CRISPR/Cas9 knock-in strategies for creating precise disease-relevant tmem38b mutations requires several considerations:

  • Template design considerations:

    • Use of single-stranded oligodeoxynucleotide (ssODN) templates for small modifications

    • Longer homology arms (>1kb) when introducing larger mutations

    • Incorporation of silent mutations to prevent re-cutting of the template or repaired locus

  • Technical optimization parameters:

    • Cas9 protein versus mRNA delivery (protein typically gives higher efficiency and lower toxicity)

    • Guide RNA selection using tools that predict high on-target and low off-target activity

    • Microinjection technique refinement to ensure consistent delivery to one-cell stage embryos

  • Screening strategies:

    • Design of efficient genotyping assays using restriction enzyme digest, high-resolution melting analysis, or sequencing

    • Early non-invasive screening using fluorescent reporters when possible

    • Establishment of reliable founder identification protocols

  • Disease-relevant mutations to consider:

    • Recreation of specific human mutations identified in OI Type XIV patients

    • Introduction of domain-specific mutations to evaluate the importance of key functional regions, similar to the KEV domain deletion already studied

    • Mutations affecting calcium binding or channel pore formation

By carefully optimizing these parameters, researchers can create zebrafish models that more precisely recapitulate human disease mutations, allowing for more translatable insights into disease mechanisms and potential treatments .

How can transcriptomic and proteomic analyses of tmem38b mutant zebrafish advance our understanding of calcium channelopathies?

Integrative transcriptomic and proteomic analyses of tmem38b mutant zebrafish can provide comprehensive insights into calcium channelopathies through:

  • Pathway identification:

    • RNA-seq analysis can reveal dysregulated gene expression networks in tmem38b-deficient tissues

    • Proteomic studies can identify changes in protein abundance, post-translational modifications, and protein-protein interactions

    • Integration of these datasets can highlight key pathways affected by calcium dysregulation beyond the known collagen processing defects

  • Temporal and tissue-specific effects:

    • Stage-specific analyses can map the progression of molecular changes from early development through adulthood

    • Tissue-specific comparisons (bone, muscle, neural tissue) can reveal differential responses to TRIC-B deficiency

    • Cell-type specific analyses can distinguish osteoblast, osteoclast, and osteocyte responses

  • Compensatory mechanisms:

    • Identification of upregulated genes/proteins that may compensate for tmem38b deficiency

    • Detection of alternative calcium channels or regulators that become activated

    • Discovery of novel stress response pathways that mitigate ER dysfunction

Such comprehensive analyses would extend beyond the focused studies currently available and could identify new therapeutic targets for OI Type XIV and related disorders .

What are the implications of studying tmem38b in the context of bone-muscle crosstalk in zebrafish models?

Studying tmem38b in the context of bone-muscle crosstalk in zebrafish offers unique insights:

  • Differential expression patterns:

    • While TMEM38A (TRIC-A) is preferentially expressed in excitable tissues like striated muscle and brain, TMEM38B (TRIC-B) has broader expression

    • This differential expression suggests tissue-specific roles and potential compensatory mechanisms

  • Functional implications:

    • TRIC channels can interact with junctophilin proteins in muscle cells to support calcium release

    • The mechanosensitive nature of bone formation means that altered muscle function could secondarily affect bone development

  • Developmental coordination:

    • The zebrafish model allows for simultaneous visualization of muscle and bone development in vivo

    • Time-course studies can reveal whether muscle defects precede, follow, or develop concurrently with bone abnormalities

  • Therapeutic relevance:

    • Understanding muscle-bone interactions could lead to novel therapeutic approaches targeting either or both tissues

    • Therapies aimed at improving muscle function might indirectly benefit bone development through improved mechanical stimulation

While current research has primarily focused on the bone phenotype of tmem38b mutants , the zebrafish model is well-positioned for integrated musculoskeletal analyses that could reveal important tissue interactions .

How does tmem38b function compare across different vertebrate model systems?

Comparative analysis of tmem38b function across vertebrate models reveals important similarities and differences:

FeatureZebrafishMouseHuman
Expression patternMaternal and embryonic expression, broadly distributedBroadly expressed in most tissuesBroadly expressed in most tissues
Null phenotype lethalityViable with skeletal defectsPerinatal lethal due to respiratory failureN/A (complete null mutations not reported)
Primary tissue affectedSkeletal systemRespiratory system, skeletal systemSkeletal system
Collagen processingUnder-modified collagen with ER retentionUnder-modified collagen with ER retentionUnder-modified collagen with ER retention
ER morphologyNot specifically reportedEnlarged ER cisternae in osteoblastsNot specifically reported
Bone cell phenotypeImpaired osteoblast and osteoclast activityImpaired osteoblast functionReduced expression of early osteoblast differentiation markers
Combined tmem38a/b deficiencyNot reportedEmbryonic lethal with cardiac failureNot reported

These cross-species comparisons highlight conserved roles in collagen processing and calcium homeostasis, while also revealing species-specific manifestations that may reflect differential compensation by other calcium regulatory mechanisms or tissue-specific requirements .

What novel applications of zebrafish tmem38b models might advance regenerative medicine research?

Zebrafish tmem38b models offer several promising applications for advancing regenerative medicine research:

  • Fin regeneration insights:

    • The caudal fin regeneration model already established for tmem38b mutants provides a powerful system for studying bone regeneration mechanisms

    • This model could be extended to test compounds that enhance regenerative capacity in the context of calcium signaling defects

    • Time-lapse imaging of the regeneration process could reveal critical cellular events regulated by TRIC-B

  • Bone repair applications:

    • Creation of bone injury models in tmem38b mutant zebrafish to study fracture healing

    • Testing of biomaterials or growth factors that might bypass the calcium signaling defects

    • Investigation of cell-based therapies using wild-type cells transplanted into mutant environments

  • Drug discovery platform:

    • High-throughput screening for compounds that rescue regenerative defects in tmem38b mutants

    • Identification of pathways that can compensate for TRIC-B deficiency

    • Development of combination therapies targeting multiple aspects of the bone formation/remodeling cycle

  • Translational potential:

    • Insights from zebrafish regeneration studies could inform therapeutic approaches for human OI Type XIV

    • Identified compounds could be tested in mammalian models and eventually clinical trials

    • Understanding the role of calcium signaling in regeneration could benefit broader regenerative medicine applications

The unique regenerative capacity of zebrafish, combined with the specific defects in tmem38b mutants, creates an ideal platform for discovering novel approaches to enhance bone repair and regeneration .

How might single-cell transcriptomics advance our understanding of tmem38b's role in different cell populations?

Single-cell transcriptomics applied to tmem38b mutant zebrafish could revolutionize our understanding of TRIC-B function through:

  • Cell-type specific responses:

    • Identification of differentially affected cell populations within bone tissue

    • Characterization of distinct transcriptional signatures in osteoblasts, osteoclasts, and osteocytes

    • Discovery of previously unrecognized cell populations affected by tmem38b deficiency

  • Developmental trajectory analysis:

    • Mapping of altered cell differentiation pathways in the absence of functional TRIC-B

    • Identification of branch points where cell fate decisions are affected by calcium signaling defects

    • Temporal resolution of compensatory responses during development

  • Niche interaction insights:

    • Analysis of communication networks between different cell types in the bone microenvironment

    • Identification of altered paracrine signaling pathways

    • Characterization of how tmem38b deficiency in one cell type affects neighboring populations

  • Heterogeneity exploration:

    • Uncovering the basis for variable phenotypic manifestations at the cellular level

    • Identification of resilient cell populations that maintain function despite tmem38b deficiency

    • Characterization of vulnerability factors that predispose certain cells to dysfunction

This approach would extend beyond current bulk tissue analyses to provide unprecedented resolution of the cellular consequences of tmem38b deficiency, potentially identifying new therapeutic targets and explanations for phenotypic variability .

What are the potential implications of studying tmem38b in relation to other calcium channelopathies and collagen-related disorders?

Studying tmem38b in relation to other calcium channelopathies and collagen-related disorders has several important implications:

  • Mechanistic overlaps:

    • Identification of shared pathways between TMEM38B-related OI and other forms of OI caused by different genetic defects

    • Discovery of common downstream effects that could be targeted therapeutically regardless of the primary genetic cause

    • Understanding how different calcium channel defects converge on similar pathological outcomes

  • Differential diagnosis markers:

    • Identification of specific biomarkers that distinguish TMEM38B-related disorders from other conditions with similar presentations

    • Development of diagnostic panels that capture the spectrum of calcium channelopathies

    • Creation of predictive tools for phenotypic severity based on molecular signatures

  • Therapeutic strategy development:

    • Repurposing of drugs developed for other calcium channelopathies for potential use in TMEM38B-related conditions

    • Identification of combination therapies that address both calcium signaling and collagen processing defects

    • Development of targeted approaches for different subtypes of calcium channel or collagen disorders

  • Evolutionary insights:

    • Understanding the conservation of calcium-dependent collagen processing mechanisms across species

    • Identification of compensatory pathways that explain species-specific differences in phenotypic manifestation

    • Discovery of fundamental principles governing ER calcium homeostasis and protein processing

These comparative approaches could yield insights beyond what would be possible through studying tmem38b in isolation, potentially benefiting patients with a broad spectrum of calcium channel and connective tissue disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.