Recombinant Danio rerio Uncharacterized protein C17orf62 homolog (zgc:91940)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cybc1; eros; zgc:91940; Cytochrome b-245 chaperone 1 homolog; Essential for reactive oxygen species protein; Eros
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
zgc:91940
Target Protein Sequence
MGYMIVEKHTSELLHLKRSPGIRSWSILVGIASVGLAAAYYSSDSILWKMFYVTGCFFVA LQNMEEWEEAVFNKSKNEIELKTFSLYTMLLTLWKRGHEKVLLDLRHLRDVSVQEERVRY LGKGYLVVLRLATGFSYPLTQSATLGSRSDVEALAALLKRFLGLEELQQRLADDDYPDDD DGIEDLGLGDSSDSQDDPDGDDDEEH
Uniprot No.

Target Background

Function

Functions as a chaperone protein essential for the stable expression of the CYBA and CYBB subunits within the cytochrome b-245 heterodimer.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is zgc:91940 and what are its alternative names?

Zgc:91940 is an uncharacterized protein C17orf62 homolog from Danio rerio (zebrafish). It has several alternative names in the scientific literature, including:

  • cybc1 (Cytochrome b-245 chaperone 1 homolog)

  • eros (Essential for reactive oxygen species protein)

  • Uncharacterized protein C17orf62 homolog

The protein is identified in UniProt database with the accession number Q6DGA7 .

What is the known function of zgc:91940?

Based on current research, zgc:91940 functions as a chaperone protein essential for the stable expression of the CYBA and CYBB subunits within the cytochrome b-245 heterodimer. This role is crucial for maintaining the functional integrity of the cytochrome b-245 complex, which is involved in reactive oxygen species (ROS) production and cellular redox regulation.

What are the recommended storage conditions for recombinant zgc:91940?

For optimal stability and activity retention of recombinant zgc:91940, follow these storage guidelines:

Storage DurationRecommended ConditionNotes
Long-term storageStore at -20°C/-80°CAliquoting is necessary for multiple use
Extended storageStore at -20°C/-80°C with 50% glycerolPrevents freeze-thaw damage
Working aliquotsStore at 4°CStable for up to one week

Repeated freeze-thaw cycles should be strictly avoided as they can significantly diminish protein activity. When preparing working stocks, the addition of 5-50% glycerol (final concentration) is recommended for long-term storage .

How should zgc:91940 be reconstituted for experimental use?

For optimal reconstitution of lyophilized zgc:91940:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Prepare small aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during the reconstitution process .

What expression systems are used to produce recombinant zgc:91940?

Recombinant zgc:91940 is typically expressed in E. coli expression systems. The full-length protein (amino acids 1-206) is often fused to an N-terminal His tag to facilitate purification through affinity chromatography. The expression in E. coli allows for high yield production of the functional protein while maintaining its structural integrity .

How can zgc:91940 be utilized in zebrafish model systems for neurological research?

Zebrafish (Danio rerio) has emerged as a valuable vertebrate model for neurological research due to genetic, organ, and cellular similarities to humans. When investigating zgc:91940's role in neurological systems:

  • CRISPR/Cas9 gene editing can be employed to create zgc:91940 knockdown or knockout zebrafish lines

  • Behavioral assays can then assess potential neurological phenotypes:

    • Open field tests measuring thigmotaxis (edge preference) as an anxiety indicator

    • Novel object approach tests to evaluate boldness/exploration behaviors

    • Social investigation tests examining conspecific interactions

These approaches can reveal how zgc:91940, through its role in cytochrome b-245 function and ROS regulation, may impact neurological development and behavior. Analysis should include comprehensive parameters such as time spent in different zones, distance traveled, and erratic swimming patterns .

What considerations should be made when designing qRT-PCR experiments to study zgc:91940 expression?

When designing qRT-PCR experiments to study zgc:91940 expression in zebrafish:

  • Select appropriate reference genes based on experimental conditions:

    • For tissue-specific studies: sep15 and metap1 are recommended as top stable genes

    • For developmental stage experiments: ube2a and tmem50a show highest stability

    • For chemical treatment studies: rpl13a and rp1p0 demonstrate superior stability

  • Avoid conventional housekeeping genes like eef1a1l1, b2m, hrpt1l and actb1, which show greater expression variability across conditions

  • Design primers specific to zgc:91940 (Q6DGA7) with optimal characteristics:

    • Amplicon size: 70-150 bp

    • GC content: 40-60%

    • Melting temperature: 58-62°C

    • Minimal secondary structure

  • Validate primer efficiency using standard curves with serial dilutions of cDNA

This approach ensures reliable quantification of zgc:91940 expression across different experimental conditions in zebrafish studies .

What is the relationship between zgc:91940 and reactive oxygen species (ROS) production in zebrafish immune function?

Zgc:91940 (also known as eros or cybc1) plays a critical role in the regulation of ROS production in zebrafish through its chaperone function for the cytochrome b-245 complex. To investigate this relationship:

  • Knockdown studies can be performed using morpholinos or CRISPR/Cas9 targeting zgc:91940

  • ROS production can be measured using:

    • Chemiluminescence assays with luminol

    • Fluorescent probes like CM-H2DCFDA or DHE

    • Hydrogen peroxide-specific probes like Amplex Red

  • Immune challenges can be introduced to assess functional consequences:

    • Bacterial infection models

    • Chemical inducers of inflammation

    • Wound healing assays

Expected outcomes in zgc:91940-deficient models include:

  • Decreased ROS production in response to stimuli

  • Compromised neutrophil respiratory burst activity

  • Potential increased susceptibility to certain pathogens

This research is particularly relevant for understanding innate immune function in zebrafish as a model for human immune disorders related to NADPH oxidase deficiencies.

How can I assess the functional activity of recombinant zgc:91940 in vitro?

To assess the functional activity of recombinant zgc:91940 in vitro:

  • Chaperone activity assay:

    • Co-express zgc:91940 with CYBA and CYBB subunits in a cell-free system

    • Measure the proper folding and assembly of the cytochrome b-245 complex using:

      • Western blot analysis for protein levels

      • Blue native PAGE for complex formation

      • Circular dichroism to assess proper protein folding

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation with CYBA and CYBB

    • Use surface plasmon resonance to measure binding kinetics

    • Employ FRET or BiFC for real-time interaction visualization

  • Functional reconstitution:

    • Reconstitute the cytochrome b-245 complex in liposomes

    • Measure electron transfer activity using cytochrome c reduction

    • Assess ROS production with chemiluminescence or fluorescent probes

These methods provide complementary approaches to characterize the chaperone function of zgc:91940 and its impact on cytochrome b-245 activity .

What are the best experimental designs to study zgc:91940 in zebrafish embryonic development?

For studying zgc:91940 in zebrafish embryonic development:

  • Temporal expression profiling:

    • Collect embryos at key developmental stages (0, 3, 6, 12, 24, 48, 72 hpf)

    • Perform qRT-PCR using validated reference genes (ube2a and tmem50a)

    • Complement with whole-mount in situ hybridization to localize expression

  • Loss-of-function studies:

    • Generate transient knockdown using morpholinos

    • Create stable mutant lines using CRISPR/Cas9

    • Design rescue experiments with mRNA injection to confirm specificity

  • Phenotypic analysis:

    • Document morphological changes using bright-field and fluorescence microscopy

    • Assess physiological parameters:

      • Heart rate and blood flow

      • ROS levels using live imaging with fluorescent probes

      • Immune cell development and function

  • Molecular pathway analysis:

    • Perform RNA-seq on wild-type and zgc:91940-deficient embryos

    • Validate differential expression using qRT-PCR

    • Conduct pathway enrichment analysis to identify affected biological processes

This comprehensive approach allows for detailed characterization of zgc:91940's role during zebrafish development .

How can high-throughput approaches be used to identify potential interaction partners of zgc:91940?

To identify potential interaction partners of zgc:91940 using high-throughput approaches:

  • Yeast two-hybrid screening:

    • Use zgc:91940 as bait against a zebrafish cDNA library

    • Validate positive interactions with secondary screens

    • Confirm with reciprocal bait-prey configurations

  • Proximity-dependent biotin identification (BioID):

    • Generate zgc:91940-BirA* fusion construct

    • Express in zebrafish cells or transgenic zebrafish

    • Purify biotinylated proteins and identify by mass spectrometry

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged zgc:91940 in zebrafish cells

    • Perform immunoprecipitation under native conditions

    • Identify co-purified proteins by LC-MS/MS

    • Use SILAC or TMT labeling for quantitative comparison

  • Protein microarray analysis:

    • Probe zebrafish protein arrays with purified zgc:91940

    • Identify binding partners through fluorescent detection

    • Validate interactions using orthogonal methods

These complementary approaches can reveal the interactome of zgc:91940, providing insights into its functional role in various cellular processes .

What are common challenges when working with zgc:91940 and how can they be addressed?

Common challenges when working with zgc:91940 and potential solutions include:

ChallengePotential CausesSolutions
Low protein activityImproper storage or reconstitutionStore with glycerol (50%), avoid freeze-thaw cycles, reconstitute in appropriate buffer
Poor solubilityAggregation, inappropriate bufferAdd mild detergents (0.1% NP-40), optimize buffer conditions, use chaotropic agents at low concentrations
Inconsistent experimental resultsVariable expression levelsUse validated reference genes for qRT-PCR (sep15, metap1 for tissue studies), standardize experimental conditions
Non-specific antibody bindingCross-reactivity with related proteinsUse epitope-tagged versions, perform blocking with specific peptides, validate antibodies in knockout/knockdown models
Morpholino off-target effectsNon-specific binding to other transcriptsInclude appropriate controls, use CRISPR/Cas9 to confirm phenotypes, perform rescue experiments

Implementing these solutions can significantly improve experimental outcomes when working with zgc:91940 in various research settings .

How can the purity and integrity of recombinant zgc:91940 be assessed?

To assess the purity and integrity of recombinant zgc:91940:

  • SDS-PAGE analysis:

    • Run samples on 12-15% polyacrylamide gels

    • Confirm the presence of a single band at the expected molecular weight (~23 kDa including His-tag)

    • Assess purity visually or using densitometry (should be >90%)

  • Western blot verification:

    • Use anti-His antibodies to detect the tagged protein

    • If available, use specific antibodies against zgc:91940

    • Confirm the absence of degradation products

  • Mass spectrometry:

    • Perform intact protein MS to verify molecular weight

    • Use peptide mapping to confirm sequence coverage

    • Identify any post-translational modifications

  • Functional assays:

    • Verify chaperone activity using in vitro assays

    • Confirm ability to bind known interacting partners

    • Assess stability under experimental conditions

These methods provide complementary information about protein quality and should be used in combination for comprehensive assessment .

What considerations should be made when designing experiments to study zgc:91940 function in different zebrafish tissues?

When designing tissue-specific experiments to study zgc:91940 function in zebrafish:

  • Tissue-specific expression analysis:

    • Use validated reference genes specifically stable in zebrafish tissues (sep15 and metap1)

    • Employ qRT-PCR with tissue-specific cDNA libraries

    • Complement with in situ hybridization for spatial resolution

  • Tissue-specific genetic manipulation:

    • Utilize Gal4-UAS or Cre-loxP systems for conditional expression

    • Generate tissue-specific promoter constructs (e.g., mpeg1 for macrophages, lyz for neutrophils)

    • Consider temporal control using heat-shock or chemical-inducible promoters

  • Functional assessment approaches:

    • For immune tissues: bacterial infection assays, inflammation models

    • For brain: behavioral assays, including thigmotaxis and novel object tests

    • For other tissues: specific functional readouts relevant to tissue type

  • Experimental controls:

    • Include both positive and negative controls for each tissue type

    • Use appropriate tissue-specific markers to confirm targeting

    • Consider potential developmental compensation in genetic models

These considerations ensure robust experimental design when investigating zgc:91940's tissue-specific functions in zebrafish .

How might zgc:91940 function be relevant to human disease models?

Zgc:91940 (cybc1/eros) function may be relevant to human disease models in several ways:

  • Immune disorders:

    • Chronic granulomatous disease (CGD) involves defects in NADPH oxidase complex

    • Human CYBC1 mutations have been identified in CGD patients

    • Zebrafish zgc:91940 models can help understand disease mechanisms and test potential therapeutics

  • Neurodegenerative conditions:

    • ROS dysregulation is implicated in numerous neurodegenerative diseases

    • Zebrafish models can assess how zgc:91940 dysfunction affects neurological parameters:

      • Behavioral changes (anxiety, exploration)

      • Neuronal survival and function

      • Microglial activation and neuroinflammation

  • Developmental disorders:

    • The zebrafish model allows investigation of zgc:91940's role in early development

    • Potential links to human developmental conditions can be explored

    • Craniofacial development studies in zebrafish may reveal connections to human disorders

These areas represent promising avenues for translational research using zgc:91940 zebrafish models to better understand human disease mechanisms .

What emerging technologies might enhance zgc:91940 research in zebrafish?

Emerging technologies that could enhance zgc:91940 research in zebrafish include:

  • Advanced gene editing approaches:

    • Prime editing for precise genetic modifications

    • Base editing for specific nucleotide changes

    • Inducible CRISPR systems for temporal control of gene editing

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-specific expression patterns

    • CRISPR-QTL mapping to understand regulatory relationships

    • Spatial transcriptomics to visualize zgc:91940 expression in tissue context

  • Advanced microscopy techniques:

    • Lightsheet microscopy for whole-organism imaging with minimal phototoxicity

    • Super-resolution microscopy for subcellular localization

    • Intravital microscopy for real-time in vivo observation

  • Functional proteomics:

    • Proximity labeling techniques (TurboID, APEX) for in vivo interactome analysis

    • Targeted protein degradation approaches (e.g., AID, dTAG) for acute protein depletion

    • Optical control of protein function using optogenetic approaches

These technologies offer powerful new ways to investigate zgc:91940 function in zebrafish with unprecedented precision and detail .

How might comparative studies of zgc:91940 across species inform our understanding of its evolutionary significance?

Comparative studies of zgc:91940 across species can provide valuable insights into its evolutionary significance:

  • Phylogenetic analysis:

    • Compare zgc:91940 sequences across vertebrate and invertebrate species

    • Identify conserved domains and motifs crucial for function

    • Determine evolutionary rates to identify selective pressures

  • Functional conservation studies:

    • Test if human CYBC1 can rescue zgc:91940 deficiency in zebrafish

    • Compare expression patterns and cellular localization across species

    • Assess functional interactions with cytochrome b-245 components in different organisms

  • Structural biology approaches:

    • Determine protein structures across multiple species

    • Identify structurally conserved regions that suggest functional importance

    • Model evolutionary changes and their impact on protein-protein interactions

  • Molecular ecology studies:

    • Examine zgc:91940 variants in wild zebrafish populations

    • Correlate genetic variations with environmental factors

    • Assess potential adaptive significance in different ecological niches

These comparative approaches can reveal how zgc:91940 function has been conserved or diversified throughout evolution, providing context for its fundamental biological roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.