Recombinant Danio rerio Uncharacterized protein C18orf19 homolog B (zgc:113036)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the order type and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zgc:113036; Uncharacterized protein C18orf19 homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
zgc:113036
Target Protein Sequence
MQRLWAPVTLRRVLLLRSVYLPHSWAMQEPRLAVLSPRYFSCTNAIRAKEAHKTSTEEQE EVPLNPPQSLAGTEGLYKADSEPVPHNKGDIDPLQDKSIGIFQRFKKTFKQYGKVMVPVH IVTSTVWFGSFYYAAMKGVNLVPFLEFIGLPDWIVGILRDSQGGYALTAYAMYKLATPAR YTVTMGGTSLSVQYLRKHGYLSTPPPVKEFLQDKMEETRELLTEKMEETKERFSEKMEET KELLSERMEETKERFSETKDKFSEKLQETKDKMSFRKKAD
Uniprot No.

Target Background

Database Links

KEGG: dre:503762

UniGene: Dr.133091

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Danio rerio Uncharacterized protein C18orf19 homolog B (zgc:113036)?

Recombinant Danio rerio Uncharacterized protein C18orf19 homolog B, also known as fam210ab or fam210a, is a protein belonging to the family with sequence similarity 210, member Ab . It is homologous to the human C18orf19 protein and is expressed in zebrafish (Danio rerio), a widely used vertebrate model organism. As an uncharacterized protein, its complete biological function remains to be fully elucidated, though it likely plays roles in developmental processes based on its expression patterns.

The protein can be produced recombinantly in various expression systems including Cell Free Expression, E. Coli, Yeast, Baculovirus, and Mammalian Cell systems, with each offering different advantages for research applications . Standard purification typically achieves ≥85% purity as determined by SDS-PAGE analysis.

What are the alternative nomenclatures and identifiers for this protein?

The protein is known by several alternative names in scientific literature and databases:

  • fam210ab (primary gene name)

  • fam210a (alternative gene name)

  • zgc:113036 (Zebrafish Gene Collection identifier)

  • Uncharacterized protein C18orf19 homolog B (descriptive name)

  • Family with sequence similarity 210, member Ab (full formal name)

When searching scientific databases, using multiple identifiers is recommended as some resources may index the protein under different nomenclatures. This protein represents one of the many uncharacterized zebrafish proteins that are subjects of ongoing research to determine their functional roles in development and physiology.

What detection methods are most effective for studying zgc:113036 expression?

Several complementary methods can be employed for optimal detection of zgc:113036:

  • Western Blotting: Using specific antibodies such as Rabbit anti-Danio rerio zgc:113036 Polyclonal Antibody for detection and semi-quantitative analysis .

  • ELISA (Enzyme-Linked Immunosorbent Assay): Offers quantitative detection with high sensitivity when studying protein expression levels across different conditions .

  • Mass Spectrometry: Provides unbiased detection and absolute quantification, particularly useful in developmental profiling studies similar to those performed for other zebrafish proteins .

  • Immunohistochemistry/Immunofluorescence: Enables spatial localization studies to determine tissue-specific expression patterns.

  • qRT-PCR: While measuring mRNA rather than protein, this method can provide insights into transcriptional regulation.

For developmental studies, it's important to note that protein and mRNA levels often don't directly correlate. For example, research on zebrafish embryogenesis showed that while more than 50% of genes showed significant changes at the mRNA level during early development, only about 20% showed significant changes at the protein level .

What expression systems are available for producing Recombinant Danio rerio zgc:113036?

Multiple expression systems are available for producing Recombinant Danio rerio zgc:113036, each with distinct advantages for different research applications:

Expression SystemAdvantagesLimitationsTypical Purity
Cell Free ExpressionRapid production, No cellular contaminants, Good for toxic proteinsLimited post-translational modifications≥85% by SDS-PAGE
E. ColiHigh yield, Cost-effective, Well-established protocolsLimited eukaryotic post-translational modifications≥85% by SDS-PAGE
YeastSome eukaryotic post-translational modifications, Higher yields than mammalian systemsMore complex than E. Coli, Different glycosylation patterns than vertebrates≥85% by SDS-PAGE
BaculovirusGood for eukaryotic proteins, More complex post-translational modificationsMore complex and costly than bacterial systems≥85% by SDS-PAGE
Mammalian CellBest for complex eukaryotic proteins, Native-like post-translational modificationsMost complex and costly, Lower yields≥85% by SDS-PAGE

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications, protein folding considerations, and the intended application of the recombinant protein.

How can researchers optimize purification of Recombinant Danio rerio zgc:113036?

Optimizing purification of Recombinant Danio rerio zgc:113036 requires a strategic approach combining multiple techniques:

  • Affinity Chromatography: The primary step typically involves using tag-specific resins (His-tag, GST, etc.) to capture the tagged recombinant protein. The choice of tag should consider the protein's characteristics and downstream applications.

  • Size Exclusion Chromatography: Following affinity purification, SEC can separate the protein from contaminants of different molecular weights and remove aggregates.

  • Ion Exchange Chromatography: Based on the protein's isoelectric point, anion or cation exchange chromatography can further improve purity.

  • Optimization Parameters:

    • Buffer composition: pH, salt concentration, and additives should be optimized to maintain protein stability and solubility

    • Temperature: Conducting purification at 4°C typically reduces proteolytic degradation

    • Protease inhibitors: Including a cocktail of inhibitors prevents degradation during purification

    • Reducing agents: DTT or β-mercaptoethanol may be necessary if the protein contains cysteine residues

  • Quality Control: SDS-PAGE analysis is commonly used to verify purity (≥85%) , while mass spectrometry can confirm identity and detect modifications or truncations.

For zebrafish proteins specifically, optimization may require considering species-specific characteristics and the native environment of the protein to maintain structural integrity during purification.

What methodologies can effectively determine the function of zgc:113036?

Determining the function of uncharacterized proteins like zgc:113036 requires a comprehensive approach:

  • Bioinformatic Analysis:

    • Sequence homology searches to identify functional domains and motifs

    • Structural prediction using tools like AlphaFold (similar to approaches used for other zebrafish proteins)

    • Phylogenetic analysis to identify evolutionary relationships with characterized proteins

  • Gene Manipulation Techniques:

    • CRISPR/Cas9-mediated knockout to observe loss-of-function phenotypes

    • Morpholino-mediated knockdown for stage-specific studies

    • Overexpression studies to observe gain-of-function effects

  • Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening for protein-protein interactions

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity

  • Expression Pattern Analysis:

    • Temporal expression profiling during development using quantitative proteomics approaches

    • Spatial expression analysis using immunohistochemistry

    • Single-cell analysis to identify cell type-specific expression

  • Rescue Experiments:

    • Reintroduction of the wild-type gene in knockout models

    • Cross-species complementation testing functional conservation

A comprehensive functional characterization would typically involve multiple approaches to build a complete picture of the protein's role in zebrafish biology.

How does zgc:113036 expression vary across zebrafish developmental stages?

The expression profile of zgc:113036 across developmental stages can be characterized using integrative approaches similar to those used in zebrafish embryogenesis studies:

  • Quantitative Proteomics Approach:

    • Mass spectrometry-based protein profiling at multiple developmental timepoints

    • Protein extraction from embryos at defined stages (1-cell stage to adult)

    • Comparison of protein abundance across stages to identify significant changes

  • Comparative Analysis with Transcriptomics:

    • Integrated analysis of protein and mRNA levels

    • Identification of post-transcriptional regulation mechanisms

    • Understanding temporal dynamics of expression

Research on zebrafish embryogenesis has shown that protein-level changes often differ significantly from mRNA-level changes during development . While over 50% of genes show significant changes at the mRNA level during early development, only about 20% show significant changes at the protein level, highlighting the importance of post-transcriptional regulation .

  • Tissue-Specific Expression:

    • Immunohistochemical analysis at different developmental stages

    • In situ hybridization to visualize spatial mRNA expression patterns

    • Single-cell analysis to identify cell type-specific expression

A thorough characterization should include statistical analysis of biological replicates, with appropriate clustering methods such as principal component analysis (PCA) to identify stage-specific expression patterns .

How can researchers investigate the evolutionary conservation of zgc:113036 across Danio species?

Investigating evolutionary conservation of zgc:113036 requires a multi-layered approach:

  • Phylogenetic Analysis:

    • Sequence comparison across Danio species and other related fish

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Analysis of selection pressure on different protein domains

Researchers studying Danio phylogeny have successfully used RAD-tag sequencing with the restriction enzyme SbfI to resolve relationships within the genus . Similar approaches could be applied to understand the evolution of zgc:113036 specifically.

  • Comparative Genomics:

    • Identification of orthologs in different species

    • Analysis of syntenic regions to understand genomic context

    • Examination of regulatory elements conservation

  • Structural Conservation:

    • Comparison of predicted protein structures across species

    • Identification of conserved functional domains

    • Analysis of critical residues conservation

  • Functional Conservation Testing:

    • Cross-species complementation experiments

    • Comparison of expression patterns across species

    • Analysis of protein-protein interaction conservation

  • Statistical Analysis:

    • Maximum likelihood (ML) and Bayesian inference methods for phylogenetic reconstruction

    • Patterson's D-statistic to detect potential introgression events

    • Calculation of evolutionary rates to identify conserved regions

Understanding the evolutionary context of zgc:113036 can provide valuable insights into its functional importance and adaptation across different fish species.

What challenges exist in designing specific antibodies against zgc:113036?

Designing specific antibodies against zgc:113036 presents several methodological challenges:

  • Epitope Selection Challenges:

    • Potential sequence similarity with related proteins (e.g., fam210a)

    • Limited structural information for optimal epitope identification

    • Need to avoid regions with post-translational modifications unless specifically targeted

  • Validation Requirements:

    • Testing against positive controls (recombinant protein) and negative controls

    • Cross-reactivity testing with related proteins

    • Validation across multiple applications (Western blot, ELISA, IHC)

  • Production Considerations:

    • Choice between polyclonal (more epitopes, batch variation) and monoclonal (single epitope, consistent) approaches

    • Selection of host species (rabbit commonly used)

    • Purification method impact on specificity (antigen-affinity purification recommended)

  • Application-Specific Optimization:

    • Different optimal conditions for Western blot versus immunohistochemistry

    • Fixation method effects on epitope accessibility

    • Sample preparation impact on antibody performance

  • Quality Control Metrics:

    • Specificity testing using knockout/knockdown samples

    • Immunoprecipitation followed by mass spectrometry validation

    • Lot-to-lot consistency testing for reproducible research

The currently available Rabbit anti-Danio rerio zgc:113036 Polyclonal Antibody has been purified using antigen-affinity methods and is validated for applications including ELISA and Western Blot .

How can size discrimination tasks in zebrafish help understand the role of proteins like zgc:113036 in neural development?

Size discrimination tasks in zebrafish provide a valuable behavioral assay for investigating the potential role of proteins like zgc:113036 in neural development and function:

  • Experimental Design Considerations:

    • The hole preference test has been validated for measuring size discrimination abilities in zebrafish

    • Fish significantly discriminate size ratios from 0.60 to 0.91, with performance decreasing as the ratio between smaller and larger hole increases

    • Test-retest analyses have shown good reliability, with 0.60 and 0.75 ratios being most informative

  • Performance Metrics and Analysis:

    • Preference for larger hole is quantified as proportion of passages

    • Linear mixed models (LMM) can be used to analyze performance differences between conditions

    • The test shows consistent performance over time (no significant day effect)

Size RatioMean Performance95% CI
0.600.732[0.594, 0.610]
0.750.602[0.594, 0.610]
0.860.527[0.518, 0.535]
0.910.554[0.546, 0.562]

Note: Performance measured as proportion of passage through larger hole

  • Application to Protein Function Studies:

    • Comparing knockout/knockdown models of zgc:113036 with wild-type controls

    • Assessing potential impairments in perceptual or cognitive abilities

    • Correlation of behavioral phenotypes with molecular and cellular changes

  • Integration with Other Approaches:

    • Combining behavioral testing with brain imaging

    • Correlating performance with protein expression levels

    • Rescue experiments to confirm specificity of effects

This approach provides quantitative behavioral phenotyping that can be particularly valuable for investigating proteins potentially involved in neural development or function.

How can zebrafish models be used to investigate the potential role of zgc:113036 in human disease?

Zebrafish models offer powerful tools for investigating potential disease associations of zgc:113036:

  • Model Generation Approaches:

    • CRISPR/Cas9-mediated knockout of zgc:113036

    • Point mutations corresponding to human disease variants

    • Conditional knockouts for temporal specificity

    • Transgenic overexpression models

  • Phenotypic Characterization:

    • Morphological assessment throughout development

    • Behavioral testing using validated paradigms like size discrimination tasks

    • Histological analysis of affected tissues

    • Functional assays specific to hypothesized disease mechanisms

  • Molecular Characterization:

    • Transcriptomic profiling to identify dysregulated pathways

    • Proteomic analysis to detect changes in interacting proteins

    • Metabolomic assessment for broader physiological impacts

    • Integration of multi-omics data for systems-level understanding

  • Translational Relevance Assessment:

    • Comparison with human patient data

    • Drug screening to identify potential therapeutic compounds

    • Rescue experiments to validate potential therapeutic targets

  • Advanced Imaging Approaches:

    • Live imaging of labeled proteins during development

    • Whole-brain imaging to assess neural impacts

    • High-resolution microscopy of subcellular localization

Zebrafish offer unique advantages for disease modeling including optical transparency, rapid development, and amenability to high-throughput screening, making them invaluable for characterizing the function of uncharacterized proteins like zgc:113036.

What approaches can resolve contradictory data between protein and RNA expression levels of zgc:113036?

Resolving contradictions between protein and RNA expression requires systematic methodological approaches:

  • Integrated Multi-omics Analysis:

    • Simultaneous measurement of mRNA and protein from the same samples

    • Correlation analysis to identify discordant patterns

    • Time-course studies to detect temporal delays between transcription and translation

Zebrafish embryogenesis studies have revealed that while more than 50% of genes change significantly at the mRNA level during early development, only about 20% show significant changes at the protein level . Additionally, fold changes are typically much smaller at the protein level (maximum FC of 32) compared to the mRNA level (maximum FC of 8,000) .

  • Post-transcriptional Regulation Investigation:

    • Analysis of miRNA regulation of zgc:113036 mRNA

    • Assessment of RNA-binding protein interactions

    • Polysome profiling to measure translational efficiency

  • Protein Stability Assessment:

    • Pulse-chase experiments to determine protein half-life

    • Proteasome inhibition studies to assess degradation pathways

    • Ubiquitination analysis to identify protein turnover mechanisms

  • Technical Validation:

    • Multiple measurement techniques for both RNA (RNA-seq, qPCR) and protein (mass spectrometry, Western blot)

    • Biological replicates with appropriate statistical analysis

    • Controls for technical artifacts in each methodology

  • Statistical Approaches:

    • Principal component analysis to identify major sources of variation

    • Hierarchical clustering to group genes with similar regulatory patterns

    • Bayesian integration of multiple data types

Understanding the relationship between mRNA and protein levels is crucial for accurate interpretation of expression data and can reveal important regulatory mechanisms governing protein abundance during development and disease.

How might emerging technologies enhance our understanding of zgc:113036 function?

Emerging technologies offer significant opportunities to advance our understanding of zgc:113036:

  • Single-Cell Multi-omics:

    • Integration of single-cell transcriptomics, proteomics, and epigenomics

    • Cell type-specific expression profiling during development

    • Identification of rare cell populations with distinctive zgc:113036 expression

  • Advanced Genome Editing:

    • Base editing for precise nucleotide modifications

    • Prime editing for targeted insertions and deletions

    • Multiplexed CRISPR screening to identify genetic interactions

  • Spatial Transcriptomics/Proteomics:

    • Visualization of zgc:113036 expression in intact tissues with spatial context

    • Correlation with anatomical features and developmental landmarks

    • Identification of localized expression domains

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of zgc:113036

    • Visualization of protein complexes containing zgc:113036

    • Structural dynamics under different conditions

  • Optogenetic and Chemogenetic Tools:

    • Temporal control of zgc:113036 expression or activity

    • Cell type-specific manipulation in vivo

    • Real-time monitoring of downstream effects

  • Artificial Intelligence Applications:

    • Improved protein structure prediction

    • Network analysis to predict protein function

    • Integration of heterogeneous data types for functional inference

These technologies promise to overcome current limitations in studying uncharacterized proteins and could provide breakthrough insights into the function of zgc:113036 in zebrafish development and physiology.

How can computational approaches predict the function of zgc:113036 when experimental data is limited?

Computational approaches offer powerful tools for predicting protein function when experimental data is limited:

  • Advanced Sequence Analysis:

    • Profile hidden Markov models to detect distant homologies

    • Conservation analysis across species to identify functional domains

    • Identification of critical residues under evolutionary selection

  • Structural Prediction and Analysis:

    • AlphaFold2 or similar tools for accurate 3D structure prediction

    • Structural alignment with proteins of known function

    • Active site and binding pocket prediction

  • Gene Co-expression Networks:

    • Identification of genes with similar expression patterns

    • Guilt-by-association inference of function

    • Pathway enrichment analysis of co-expressed genes

  • Protein-Protein Interaction Prediction:

    • Structure-based interaction prediction

    • Text mining of scientific literature for potential interactions

    • Cross-species interaction data integration

  • Machine Learning Approaches:

    • Function prediction based on multiple features

    • Deep learning models trained on diverse protein datasets

    • Transfer learning from well-characterized proteins

  • Systems Biology Integration:

    • Mathematical modeling of relevant biological pathways

    • Flux balance analysis for metabolic context

    • Network perturbation analysis to predict functional impact

These computational approaches can generate testable hypotheses about zgc:113036 function, guiding experimental design and focusing laboratory efforts on the most promising directions for functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.