Recombinant Danio rerio Uncharacterized protein C3orf17 homolog (si:dkey-22a1.3, zgc:112065)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nepro; si:dkey-22a1.3; zgc:112065; Nucleolus and neural progenitor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
nepro
Target Protein Sequence
MAQECWNKINIPFPSAVSSTRIPFTGSIDLLIDCLLADCEKVLTLLCSEVLQTEIRVLYE LLYILNNGFRQHKPFRALKQVEQCVNRLKEMKLQAAVEDLKEVCPNKFQREAGAEAGECD VPSQPMLEWLGLKLLGASSLLARTLERCTKTFLLTRQHLRLGEFIVLNVVITSMLSRLWV FFRGILRALIPMYRRNCELLQKVSQSQPMAYLTDFTLPEDLKDFLCLTYPDLKIEEVTKD LLKGTRGKRKSKFSLLSKLFGDTEQQEEIGEGERDLMPILSAGHYEVSSLDLGAAVSQRR TDYSDVSPYGLGIKAMLQQSSKTTKQKSLEQQMKLDSSSKASLCQKRTSLKKTSSFRNMA ALLKELMNWCRSCKFYQEHKRLAFLSLKCGRMESLEAEGVRVEKRLKTFKIKVQKALTLQ QTFPPKHSCSLPALLRTRWQNKFFMRHFRTLRRRSAVSRKSSGTVKGSLNQRRKCRPLLQ SSNEVESGENVTASVEIEKMDSQTSLQEPNIPKDDIDDIFESFGF
Uniprot No.

Target Background

Function

May play a role in the Notch signaling pathway.

Database Links
Protein Families
Nepro family
Subcellular Location
Nucleus. Nucleus, nucleolus.

Q&A

What is the Uncharacterized Protein C3orf17 Homolog in Danio rerio?

The uncharacterized protein C3orf17 homolog is a protein encoded by the nepro gene in zebrafish (Danio rerio). It is also known by alternative identifiers including si:dkey-22a1.3 and zgc:112065. The full name is "nucleolus and neural progenitor protein," suggesting potential roles in nucleolar function and neural development . The protein has a UniProt accession number of Q567G6 and consists of 525 amino acids with a complete sequence that has been characterized .

How should researchers store and handle recombinant Danio rerio C3orf17 homolog protein?

For optimal results, store the recombinant protein at -20°C for regular use, or at -80°C for extended storage. The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability. To avoid protein degradation, minimize freeze-thaw cycles; instead, prepare working aliquots and store them at 4°C for up to one week. When manipulating the protein for experiments, maintain cold chain conditions and use appropriate protease inhibitors if performing longer protocols .

What expression systems are recommended for producing this recombinant protein?

While the search results don't specify the expression system for this particular protein, standard approaches for zebrafish protein expression include bacterial systems (E. coli BL21 or Rosetta strains) for non-glycosylated proteins, and eukaryotic systems (insect cells, mammalian cells) when post-translational modifications are essential. When designing expression constructs, consider codon optimization for the host system and include appropriate purification tags that won't interfere with the protein's function. For this uncharacterized protein, comparing expression in multiple systems might provide insights into potential post-translational modifications.

What approaches should be used to investigate potential functions of this uncharacterized protein?

Investigating uncharacterized proteins like C3orf17 homolog requires a multi-faceted approach:

  • Sequence and structural analysis: Use tools like HHPred for remote homology detection to identify structural similarities to characterized proteins, as demonstrated in studies of other uncharacterized proteins .

  • Subcellular localization: Employ immunofluorescence microscopy with specific antibodies or tagged recombinant versions to determine localization patterns, which can provide functional clues.

  • Protein-protein interaction studies: Utilize proximity labeling mass spectrometry approaches (similar to those used for C17orf80) to identify potential interacting partners .

  • Genetic perturbation: Apply CRISPR-Cas9 or morpholino-based knockdown/knockout strategies in zebrafish to observe resulting phenotypes.

  • Transcriptomic analysis: Examine expression patterns across tissues and developmental stages to identify potential functional correlations.

The integrative approach used in studies of other uncharacterized proteins demonstrates that combining these methods can effectively reveal functional characteristics even for proteins with no previously known functions .

How can researchers validate antibodies for studies of C3orf17 homolog?

Antibody validation is critical for uncharacterized proteins to ensure specificity. A comprehensive validation approach should include:

  • siRNA-mediated depletion: Knock down the target protein and confirm reduced signal in immunofluorescence or Western blot, similar to approaches used for C17orf80 validation .

  • Recombinant protein expression: Express tagged versions (e.g., Myc-tagged) of the protein and confirm colocalization of signals from both the tag-specific antibody and the protein-specific antibody .

  • Mass spectrometry validation: Immunoprecipitate the protein using the antibody and confirm identity by mass spectrometry.

  • Cross-reactivity testing: Test the antibody against related proteins or in knockout models to ensure specificity.

  • Multiple antibody concordance: Use multiple antibodies targeting different epitopes to confirm findings.

These approaches have proven effective in validating antibodies for other uncharacterized proteins, significantly reducing the risk of misinterpreting experimental results .

What are the recommended approaches for investigating potential interaction partners of C3orf17 homolog?

For uncharacterized proteins, identifying interaction partners is crucial for functional characterization. Several complementary approaches are recommended:

  • Proximity labeling proteomics: Methods such as BioID or APEX can identify proteins in close spatial proximity to C3orf17 homolog in living cells. This approach has successfully identified interaction networks for other uncharacterized proteins .

  • Co-immunoprecipitation followed by mass spectrometry: This can identify stable interaction partners, though careful control experiments are essential to distinguish specific interactions from background.

  • Yeast two-hybrid screening: While this may yield false positives, it can identify direct binary interactions and complement co-IP approaches.

  • Crosslinking mass spectrometry: This can capture transient interactions and provide structural information about interaction interfaces.

  • Functional validation: Confirm key interactions through knockdown/knockout of potential partners and observe effects on localization or function of C3orf17 homolog.

For optimal results, researchers should implement multiple independent methods and focus on interactions reproduced across different experimental approaches .

How should researchers approach the investigation of C3orf17 homolog's potential role in zebrafish development?

Given that the protein is encoded by the nepro gene (nucleolus and neural progenitor protein), investigating its developmental role requires a systematic approach:

  • Temporal expression analysis: Characterize expression patterns throughout developmental stages using qRT-PCR, in situ hybridization, and developmental proteomics.

  • Spatial expression mapping: Determine tissue-specific expression patterns, with particular attention to neural tissues given the "neural progenitor protein" designation.

  • Loss-of-function studies: Generate transient (morpholino) and stable (CRISPR-Cas9) knockdown/knockout models to observe developmental phenotypes.

  • Rescue experiments: Perform functional complementation with wild-type or mutant versions of the protein to validate specificity of phenotypes.

  • Lineage tracing: If neural progenitor involvement is suspected, employ lineage tracing methods to examine effects on neural cell fate determination.

This systematic approach will help elucidate whether C3orf17 homolog plays critical roles in zebrafish development, particularly in neural development contexts.

What are the recommended experimental conditions for functional assays with this protein?

When designing functional assays for C3orf17 homolog, researchers should consider:

  • Buffer optimization: Test multiple buffer conditions (varying pH, salt concentration, and additives) to maintain protein stability and function.

  • Temperature sensitivity: Evaluate activity at different temperatures, considering that zebrafish optimal temperature (28°C) differs from mammalian systems.

  • Cofactor requirements: Screen for potential cofactors that might be required for function, including metal ions, nucleotides, or other small molecules.

  • Protein concentration ranges: Establish concentration-dependent effects to identify physiologically relevant working ranges.

  • Post-translational modifications: Consider how phosphorylation, acetylation, or other modifications might influence function.

For uncharacterized proteins, establishing appropriate assay conditions often requires iterative optimization based on preliminary functional hypotheses derived from localization and interaction studies .

How can researchers design effective domain-swap or mutation experiments to probe structure-function relationships?

Structure-function analysis for uncharacterized proteins requires systematic experimental design:

  • Sequence conservation analysis: Identify highly conserved residues across species, which often indicate functional importance.

  • Structural prediction integration: Use AlphaFold2 or similar tools to predict structural elements and prioritize regions for mutagenesis .

  • Systematic mutation strategy: Design mutations that:

    • Alter conserved residues

    • Modify predicted functional motifs

    • Disrupt predicted structural elements

    • Include appropriate controls (e.g., mutations of non-conserved residues)

  • Functional readouts: Establish clear functional assays to evaluate the effects of mutations, potentially including:

    • Subcellular localization

    • Protein-protein interactions

    • Developmental phenotypes in model systems

  • Domain swapping: For predicted domains, create chimeric proteins with corresponding domains from related proteins to assess functional conservation.

This approach has proven successful in delineating structure-function relationships for other previously uncharacterized proteins .

What considerations should researchers take into account when designing CRISPR-Cas9 knockout or knockin strategies for this gene?

CRISPR-Cas9 genetic modification of the nepro gene (encoding C3orf17 homolog) requires careful planning:

  • Guide RNA design considerations:

    • Target early exons to ensure complete loss-of-function

    • Evaluate potential off-target effects using zebrafish-specific prediction tools

    • Design multiple guide RNAs to increase success probability

    • Consider targeting conserved domains if partial knockouts are desired

  • Genotyping strategy development:

    • Design primers flanking the target site for PCR-based genotyping

    • Consider restriction enzyme sites that may be created or destroyed by editing

    • Plan sequencing strategies to confirm exact modifications

  • Phenotypic analysis planning:

    • Based on the "nucleolus and neural progenitor protein" designation, prioritize examination of:

      • Neural development parameters

      • Nucleolar structure and function

      • Cell proliferation in developing tissues

    • Include molecular, cellular, and organismal level analyses

  • Controls and rescue experiments:

    • Generate appropriate control lines

    • Prepare rescue constructs for complementation testing

    • Consider conditional approaches if complete knockout is lethal

This comprehensive approach maximizes the likelihood of generating informative zebrafish models for functional studies of C3orf17 homolog.

How does the C3orf17 homolog in zebrafish compare to orthologous proteins in other species?

Understanding evolutionary relationships provides important context for functional studies:

  • Sequence conservation analysis: The C3orf17 homolog shows varying degrees of conservation across vertebrates, with higher conservation in specific protein regions that may indicate functional domains. Detailed comparative sequence analysis should focus on:

    • Identification of conserved motifs

    • Species-specific variations that might relate to functional specialization

    • Correlation of conservation patterns with predicted structural elements

  • Expression pattern comparison: Examine whether orthologs in other species share similar tissue expression patterns, particularly regarding neural and nucleolar expression.

  • Known functions in other species: While the zebrafish protein is uncharacterized, orthologs in other species may have more established functions that could guide hypothesis generation for the zebrafish protein.

  • Evolutionary rate analysis: Determine whether the gene has undergone rapid evolution or remained highly conserved, which can provide clues about functional constraints and adaptations.

This evolutionary perspective can significantly inform experimental design for functional studies in zebrafish.

What approaches should be used to integrate findings from zebrafish C3orf17 homolog studies with knowledge from mammalian models?

Translating findings between zebrafish and mammalian systems requires careful consideration:

  • Ortholog identification and validation: Confirm true orthologous relationships between the zebrafish C3orf17 homolog and mammalian counterparts through:

    • Reciprocal BLAST analysis

    • Synteny examination

    • Phylogenetic tree construction

  • Functional conservation testing: Determine whether the zebrafish protein can rescue phenotypes in mammalian cellular models lacking the orthologous protein, and vice versa.

  • Expression pattern comparison: Compare tissue-specific and developmental expression patterns between zebrafish and mammalian orthologs to identify conserved and divergent aspects.

  • Interaction network comparison: Determine whether protein interaction partners are conserved between species, which would suggest functional conservation.

  • Regulatory mechanism investigation: Compare transcriptional and post-transcriptional regulation between species to identify conserved regulatory principles.

This integrative approach facilitates appropriate translation of findings between model systems and assessment of potential relevance to human biology.

What emerging technologies might accelerate functional characterization of C3orf17 homolog?

Several cutting-edge approaches could significantly advance understanding of this uncharacterized protein:

  • Spatial transcriptomics and proteomics: These techniques can provide high-resolution spatial information about expression patterns in developing zebrafish embryos.

  • Advanced proximity labeling: Newer proximity labeling approaches with improved spatiotemporal resolution could more precisely identify interaction partners in specific cellular compartments.

  • Cryo-electron tomography: This technique could provide structural insights into the protein's native conformation and interactions within cellular complexes.

  • Base editing and prime editing: These refined CRISPR technologies enable more precise genetic modifications with reduced off-target effects.

  • Single-cell multi-omics: Integrating transcriptomic, proteomic, and epigenomic data at single-cell resolution could reveal cell type-specific functions.

  • Meta-analysis approaches: Similar to those used for FAM81A characterization, systematic analysis of multiple proteomics datasets could reveal patterns of co-occurrence with proteins of known function .

These emerging technologies complement established approaches and may provide breakthrough insights into the function of this uncharacterized protein.

How should researchers approach the potential connection between C3orf17 homolog and disease models?

Investigating potential disease relevance requires systematic analysis:

  • Human ortholog disease association: Determine whether the human ortholog of C3orf17 homolog has been implicated in genetic studies of human diseases.

  • Expression analysis in disease models: Examine whether expression levels change in zebrafish models of relevant diseases, particularly neurodevelopmental conditions given the neural progenitor connection.

  • Genetic interaction studies: Test for genetic interactions with known disease-associated genes in zebrafish, particularly those involved in neural development.

  • Phenotypic comparison: Compare phenotypes of C3orf17 homolog knockdown/knockout with known disease phenotypes in zebrafish.

  • Drug response modification: Assess whether modulation of C3orf17 homolog levels affects response to therapeutic compounds in disease models.

This systematic approach can help establish whether this uncharacterized protein has potential relevance to human disease mechanisms, similar to how other initially uncharacterized proteins have ultimately been connected to pathological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.