Recombinant Danio rerio Uncharacterized transmembrane protein C1orf95 homolog (si:dkeyp-59a8.4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
si:dkeyp-59a8.4; Protein stum homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
si:dkeyp-59a8.4
Target Protein Sequence
MDQKDTEMNEKGVSSSTSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFV SAFTVLCGARTDLPDRHMCCVFWLNIAAAFIQIVTAVVMVGWIMSIFWGMDMVILAKGYR EQSVPQQL
Uniprot No.

Target Background

Database Links

KEGG: dre:562918

UniGene: Dr.83563

Protein Families
SPEC3 family, Stum subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions and Answers

  • How is the C1orf95 homolog encoded in the zebrafish genome?

    The protein is encoded by the gene si:dkeyp-59a8.4 in the zebrafish genome. This gene belongs to the uncharacterized open reading frames (ORFs) category. The protein has been assigned UniProt ID Q5TYP8 and is also sometimes referred to as "Protein stum homolog" in some databases .

  • What expression patterns have been observed for si:dkeyp-59a8.4 during zebrafish development?

    While specific expression patterns for si:dkeyp-59a8.4 are not explicitly detailed in the available literature, research in zebrafish proteomics has identified thousands of proteins across 10 stages of zebrafish embryonic development. Such comprehensive proteomics studies can reveal temporal expression patterns of transmembrane proteins like si:dkeyp-59a8.4 during embryogenesis .

Advanced Research Questions and Answers

  • What is the potential relationship between C1orf95 homologs and disease states, particularly cancer?

    Research indicates that C1orf95 may have implications in cancer biology. In human studies, C1orf95 showed somatic mutations in pancreatic tumors, with mutations appearing in more than 10% of patients analyzed. Genome-Wide Association Studies (GWAS) data from the International Cancer Genome Consortium (ICGC) database revealed that C1orf95, among other ORFs, exhibited elevated copy number and over-expression in pancreatic tumor patients .

    The table below summarizes findings related to C1orf95 and other ORFs in pancreatic cancer:

    ORFFindings in Pancreatic Cancer
    C1orf95Mutations in >10% of patients, elevated copy number, over-expression
    C7orf8Mutations in >10% of patients
    C7orf10Mutations in >10% of patients, 38.1% mutation rate
    C20orf39Mutations in >10% of patients
    C20orf45Mutations in >10% of patients
    FAM19A5Mutations in >10% of patients, 42.86% mutation rate
  • How can one assess the functional role of si:dkeyp-59a8.4 in cellular signaling pathways?

    To assess the functional role of this protein in signaling pathways, researchers could employ:

    1. Gene knockdown/knockout approaches using morpholinos or CRISPR-Cas9 in zebrafish

    2. Expression analysis in different tissues using qPCR or immunohistochemistry

    3. Co-immunoprecipitation to identify protein-protein interactions

    4. Calcium imaging to detect if the protein affects calcium signaling (based on observations that transmembrane proteins can affect calcium dynamics)

    5. Analysis of effects on Gq signaling, as transmembrane proteins can interact with G-protein coupled receptors and affect downstream pathways

    For instance, research on transmembrane proteins in zebrafish has shown that they can impact calcium flashing and diacylglycerol (DAG) production, which activates Protein Kinase C (PKC) signaling .

  • What experimental approaches are optimal for studying potential immune-related functions of si:dkeyp-59a8.4?

    Based on research methodologies used for other transmembrane proteins:

    1. Recombinant protein binding assays with immune system components

    2. Bacterial challenge experiments in zebrafish with gene knockdown/overexpression

    3. Enzyme-linked immunosorbent assay (ELISA) to test binding to immunologically relevant molecules

    4. Assessment of neutrophil and macrophage recruitment in zebrafish larvae with altered protein expression

    5. Transcriptome analysis to evaluate immune-related gene expression changes

    Similar experimental designs have been successfully applied to characterize other transmembrane C-type lectins in fish, revealing their roles in host defense against bacterial infection .

Methodological Questions and Answers

  • What expression systems and purification methods are recommended for recombinant production of si:dkeyp-59a8.4?

    For optimal recombinant expression and purification:

    1. Expression Systems:

      • E. coli BL21(DE3) has been successfully used for expressing zebrafish transmembrane proteins

      • Consider human cell lines for proper post-translational modifications

    2. Expression Vectors:

      • pGEX-6p-2 vector (for GST-tagged fusion proteins)

      • Vectors with His-tag options are also viable

    3. Purification Methods:

      • For GST-tagged proteins: glutathione affinity chromatography

      • For His-tagged proteins: immobilized metal affinity chromatography

      • Size exclusion chromatography for final polishing

    4. Storage Recommendations:

      • Store at -20°C/-80°C in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

      • Avoid repeated freeze-thaw cycles

      • For working aliquots, store at 4°C for up to one week

  • What functional assays can be used to assess the activity of recombinant si:dkeyp-59a8.4?

    Several functional assays can be employed:

    1. Binding Assays:

      • Direct binding ELISA with potential ligands

      • Surface Plasmon Resonance (SPR) for real-time binding kinetics

    2. Cellular Assays:

      • Cell-based reporter assays for signaling pathway activation

      • Calcium flux assays if linked to calcium signaling

      • Membrane localization studies using fluorescently tagged protein

    3. In vivo Zebrafish Assays:

      • Microinjection of recombinant protein into zebrafish embryos

      • Assessment of phenotypic changes similar to those observed in PMA-treated embryos

      • Evaluation of neutrophil and macrophage recruitment

  • How can feeding and environmental conditions affect experimental outcomes when studying si:dkeyp-59a8.4 in zebrafish models?

    When designing zebrafish experiments to study this protein:

    1. Feeding Considerations:

      • Standardize feeding rates (restrictive vs. satiation feeding)

      • Control protein quality in diets (fishmeal vs. plant-based)

      • Both factors can differentially affect growth, feed conversion ratio, and potentially gene expression

    2. Environmental Variables to Control:

      • Water temperature and quality parameters

      • Light cycles

      • Population density

      • Age standardization

    Research shows that feeding rate and protein quality individually and interactively affect feed intake and feed conversion ratio in zebrafish, potentially influencing experimental outcomes related to protein expression and function .

  • What approaches can be used to investigate the potential role of si:dkeyp-59a8.4 in development and morphogenesis?

    The following methodological approaches are recommended:

    1. Temporal Expression Analysis:

      • Utilize quantitative proteomics across developmental timepoints

      • Apply weighted gene coexpression network analysis (WGCNA) to identify co-expressed protein modules

    2. Spatial Expression Mapping:

      • Whole-mount in situ hybridization

      • Immunohistochemistry with specific antibodies

    3. Functional Perturbation:

      • Gene knockout using CRISPR-Cas9

      • Morpholino-mediated knockdown

      • mRNA overexpression

      • Evaluate effects on epithelial integrity, similar to studies on other transmembrane proteins

    4. Live Imaging:

      • Use transgenic lines such as Tg(krtt1c19e:lyn-tdtomato) for visualizing effects on epithelial cells

      • Time-lapse microscopy to track cellular behaviors during morphogenesis

  • How can researchers assess the potential role of si:dkeyp-59a8.4 in immune responses?

    Based on methodologies used for similar proteins:

    1. Bacterial Challenge Experiments:

      • Expose zebrafish with altered si:dkeyp-59a8.4 expression to bacterial pathogens

      • Assess survival rates, bacterial burden, and immune cell recruitment

    2. Agglutination Assays:

      • Test if recombinant protein can agglutinate bacteria in the presence/absence of Ca²⁺

      • Include both Gram-positive and Gram-negative bacteria for comprehensive analysis

    3. Microorganism Binding Assays:

      • Determine direct binding capabilities to microbial cells

      • Analyze binding to various polysaccharides (LPS, PGN) using ELISA

    4. Growth Inhibition Assays:

      • Examine effects of recombinant protein on bacterial growth curves

      • Compare with appropriate controls (e.g., GST-tag protein alone)

  • What considerations are important when designing expression constructs for si:dkeyp-59a8.4?

    When designing expression constructs:

    1. Codon Optimization:

      • Adjust codons based on the expression system (E. coli vs. eukaryotic)

      • Consider rare codon usage in the target expression system

    2. Domain Architecture:

      • Express full-length protein (1-128 amino acids) for complete functional studies

      • Consider expressing specific domains separately (e.g., transmembrane region only)

    3. Fusion Tags:

      • N-terminal His-tag has been successfully used

      • GST-tag may improve solubility

      • Include a precision protease cleavage site if tag removal is desired

    4. Primer Design for Amplification:

      • Include appropriate restriction sites (e.g., EcoRI and XhoI)

      • Ensure in-frame cloning with fusion tags

      • Example forward primer might include sequences like:
        5'-GGATCCCCAGGAATTCCCTGTGACGAGGACTGGCTGCCC-3'

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.