Recombinant Danio rerio UPF0444 transmembrane protein C12orf23 homolog (si:dkey-227k11.2, zgc:64098)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Danio rerio UPF0444 transmembrane protein C12orf23 homolog (si:dkey-227k11.2, zgc:64098) is a protein that, in Danio rerio (zebrafish), is also known as UPF0444 transmembrane protein C12orf23 homolog . The protein's recommended name is UPF0444 transmembrane protein C12orf23 homolog . The ORF names are si:dkey-227k11.2 and zgc:64098 .

Basic Properties

PropertyValue
SpeciesDanio rerio (Zebrafish) (Brachydanio rerio)
UniProt No.Q7T352
Expression Region1-120
AA SequenceMSETNQQRDDLPAYLNDEPPADANKDHPQPQPGMFSRVAGGLFSVTKGAVGATVGGVAWVGGKSFDLTKTAVTSVASVPAMGVGLVKGGVSAVAGGVTAVGSAVVSKVPIGGGKKKDKSD

Functional Studies

While specific functional studies directly on Danio rerio UPF0444 transmembrane protein C12orf23 homolog (si:dkey-227k11.2, zgc:64098) were not found in the resources, research on other transmembrane proteins in zebrafish provides relevant context:

  • Prom1b: Deletion of Prom1b, another transmembrane protein in zebrafish, disrupts outer-segment morphogenesis and causes photoreceptor degeneration, highlighting the importance of transmembrane proteins in retinal structure and function .
    Fzd6: Studies on Fzd6-knockin mice found that the mice presented greater immobility in the forced swimming test, less preference for sucrose in the sucrose preference test, as well as decreased center entries, center time, and distance traveled in the open filed test compared with WT mice after exposure to chronic social defeat stress, which indicates the involvement of rs61753730 in depression .

Implications for Further Research

Further research is needed to elucidate the precise function of the UPF0444 transmembrane protein C12orf23 homolog. Studies could involve:

  • Knockdown/Knockout Studies: Generating zebrafish lines with targeted disruptions of the gene to observe phenotypic changes.

  • Protein Interaction Studies: Identifying interacting proteins to understand its role in cellular pathways.

  • Expression Analysis: Examining the protein's expression patterns in different tissues and developmental stages.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
tmem263; si:dkey-227k11.2; zgc:64098; Transmembrane protein 263
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem263
Target Protein Sequence
MSETNQQRDDLPAYLNDEPPADANKDHPQPQPGMFSRVAGGLFSVTKGAVGATVGGVAWV GGKSFDLTKTAVTSVASVPAMGVGLVKGGVSAVAGGVTAVGSAVVSKVPIGGGKKKDKSD
Uniprot No.

Target Background

Database Links

KEGG: dre:406415

UniGene: Dr.76394

Protein Families
TMEM263 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM263 protein and what are its alternative nomenclatures?

TMEM263 (transmembrane protein 263) in Danio rerio has several nomenclature variations in research literature. This protein is identified under multiple gene names including tmem263, zgc:64098, and wu:fc21f01, reflecting different database classifications and historical discovery pathways . The protein is a homolog of human UPF0444 transmembrane protein C12orf23. The systematic identifier si:dkey-227k11.2 refers to the genomic location. Understanding these alternative designations is essential when conducting literature searches and database queries to ensure comprehensive coverage of existing research.

What expression systems are typically used for producing recombinant Danio rerio TMEM263?

Recombinant Danio rerio TMEM263 is primarily produced using cell-free expression systems, which provide several advantages for transmembrane protein production. This system allows for the expression of proteins that might be toxic to living cells and enables precise control over reaction conditions . For researchers seeking alternative expression platforms, E. coli, yeast, baculovirus, and mammalian cell systems may also be considered, particularly for partial constructs or fusion proteins. When selecting an expression system, considerations should include the required post-translational modifications, intended downstream applications, and structural integrity needs.

What is the typical purity level of commercially available recombinant TMEM263, and how is it determined?

Commercial preparations of recombinant Danio rerio TMEM263 typically achieve a purity level greater than or equal to 85% as determined by SDS-PAGE analysis . This analytical method separates proteins based on molecular weight, allowing quantification of target protein purity relative to contaminants. Researchers should be aware that different applications may require different purity thresholds. For structural studies or sensitive functional assays, higher purity may be necessary, potentially requiring additional purification steps beyond what commercial preparations provide.

How can TMEM263 be effectively utilized in zebrafish developmental studies?

When designing developmental studies incorporating TMEM263 in zebrafish, researchers should consider the inherent advantages of this model organism. Zebrafish offer transparent embryos, rapid development, and genetic tractability that facilitate investigation of protein function in vivo . Based on the characteristics of transmembrane proteins, effective experimental designs could include:

  • Temporal expression analysis to map TMEM263 presence throughout developmental stages

  • Spatial localization studies using fluorescent tagging techniques

  • Loss-of-function approaches through morpholino knockdown or CRISPR-Cas9 gene editing

  • Rescue experiments with recombinant protein to validate specificity of observed phenotypes

Particular attention should be paid to potential strain-specific differences, as laboratory strains of zebrafish may represent only a fraction of the genetic diversity present within wild populations .

What methods are recommended for detecting TMEM263 expression in zebrafish tissues?

For comprehensive detection of TMEM263 expression in zebrafish tissues, a multi-method approach is recommended:

MethodApplicationSensitivitySpecial Considerations
Western BlotProtein quantificationModerateRequires specific antibodies, optimal for comparing expression levels between samples
ELISAQuantitative detectionHighUseful for high-throughput screening, requires validation for cross-reactivity
ImmunohistochemistrySpatial localizationModeratePreserves tissue architecture, allows cellular localization
RT-PCR/qPCRmRNA expressionHighMeasures transcript rather than protein levels
In situ hybridizationSpatial mRNA detectionModerateUseful for developmental studies, complements protein detection methods

When selecting antibodies, rabbit polyclonal antibodies against Danio rerio TMEM263 have been validated for specific applications including ELISA and Western Blot . Researchers should perform validation experiments for any novel tissue types or developmental stages.

How might genetic diversity in zebrafish populations affect TMEM263 functional studies?

Laboratory strains of zebrafish used in most research settings represent only a fraction of the genetic diversity present in wild zebrafish populations . This reduced genetic diversity has important implications for TMEM263 functional studies:

  • Allelic variation effects: Wild zebrafish from India, Nepal, and Bangladesh demonstrate significantly higher genetic diversity than laboratory strains . This suggests potential functional variations in TMEM263 may exist in natural populations but remain unexplored in common laboratory strains.

  • GC-biased gene conversion: Wild zebrafish exhibit clear signals of GC-biased gene conversion that are missing in laboratory strains . This evolutionary mechanism potentially affects nucleotide composition and may influence TMEM263 evolution differently between wild and laboratory populations.

  • Strain isolation effects: Different laboratory isolates of the same strain kept in different facilities show patterns of ongoing differentiation into genetically distinct substrains . Researchers should therefore validate findings across multiple strains or consider using wild-derived strains as additional controls.

For comprehensive functional characterization, researchers might consider complementing standard laboratory strain studies with experiments using fish from diverse genetic backgrounds, particularly from the most genetically distinct populations identified in Nepal and Bangladesh .

What are the challenges in studying TMEM263 in the context of meiosis research in zebrafish?

Investigating TMEM263 in the context of meiosis presents specific challenges due to the complex nature of meiotic processes in zebrafish. Zebrafish telomere bouquet research has revealed that axis morphogenesis, synapsis, and double-strand break formation all occur near telomeres . If TMEM263 plays a role in these processes, researchers should consider:

  • Sex-specific differences: Reproductive phenotypes in zebrafish can differ dramatically between males and females, as demonstrated in spo11 mutants where males fail to produce sperm while females produce offspring with developmental defects . Any TMEM263 functional studies should examine both sexes separately.

  • Spatiotemporal resolution: Super-resolution microscopy has been essential for elucidating meiotic events in zebrafish . Similar high-resolution approaches would be necessary to precisely localize TMEM263 during meiotic progression.

  • Protein interactions: If TMEM263 interacts with meiotic machinery, co-immunoprecipitation or proximity labeling approaches would be valuable to identify interaction partners, potentially including axis proteins like Sycp3 that load adjacent to telomeres .

What considerations should be made when designing structural studies of TMEM263?

As a transmembrane protein, TMEM263 presents unique challenges for structural characterization. Researchers should consider the following methodological approaches:

  • Membrane mimetics selection: Choose appropriate membrane mimetics (detergents, nanodiscs, liposomes) that maintain protein structure while enabling analysis.

  • Construct design: For crystallography or cryo-EM studies, engineered constructs with terminal tags, truncations of disordered regions, or fusion partners may improve structural determination success.

  • Biophysical validation: Employ circular dichroism, thermal shift assays, and size exclusion chromatography to verify proper folding and stability before committing to large-scale structural studies.

  • Computational prediction: Utilize homology modeling based on the human ortholog C12orf23 (TMEM263) as a starting point for structural hypotheses.

A combined approach integrating computational prediction with experimental validation will likely yield the most robust structural insights.

What is the recommended protocol for reconstituting recombinant TMEM263 for functional studies?

When reconstituting recombinant TMEM263 for functional studies, the following step-by-step protocol is recommended:

  • Storage assessment: Commercial recombinant TMEM263 is typically stored lyophilized or in stabilizing buffers at -80°C . Check specific storage conditions.

  • Reconstitution procedure:

    • Equilibrate the protein vial to room temperature (15-25°C) before opening

    • Reconstitute in sterile, ultrapure water or buffer recommended by the supplier

    • Gently mix by rotating or inverting the vial (avoid vortexing to prevent protein denaturation)

    • Allow complete solubilization (typically 10-20 minutes at room temperature)

  • Concentration determination:

    • Measure protein concentration using Bradford assay or BCA assay

    • Adjust to desired working concentration using appropriate buffer

  • Functional validation:

    • Verify protein activity using application-specific assays

    • For membrane proteins, consider reconstitution in liposomes or nanodiscs for functional studies

For transmembrane proteins like TMEM263, maintaining proper folding is critical. If aggregation occurs, optimize buffer conditions by adjusting salt concentration, pH, or adding stabilizing agents like glycerol.

How can researchers optimize antibody-based detection of TMEM263 in zebrafish samples?

To optimize antibody-based detection of TMEM263 in zebrafish samples, researchers should implement the following protocol refinements:

  • Antibody selection: Rabbit polyclonal antibodies against Danio rerio TMEM263 have been validated for applications including ELISA and Western Blot . For novel applications, validation is essential.

  • Sample preparation optimization:

    • For membrane proteins, evaluate different lysis buffers containing various detergents (CHAPS, NP-40, Triton X-100)

    • Include protease inhibitors to prevent degradation

    • For fixed tissues, optimize fixation time to balance epitope preservation and tissue penetration

  • Signal enhancement strategies:

    • Implement antigen retrieval techniques (heat-induced or enzymatic) for fixed tissues

    • Evaluate signal amplification systems (tyramide signal amplification, polymer-based detection)

    • Optimize antibody concentration through titration experiments

  • Validation controls:

    • Include positive controls (tissues known to express TMEM263)

    • Negative controls (competitive blocking with recombinant protein)

    • Knockout/knockdown validation if available

If background staining persists, implement additional blocking steps with normal serum or BSA, and consider using specialized blocking reagents for zebrafish tissues.

How might integrating wild zebrafish genetic diversity enhance TMEM263 functional characterization?

Future research initiatives could benefit from integrating wild zebrafish genetic diversity to enhance TMEM263 functional characterization. Considering that laboratory strains represent only a fraction of natural genetic diversity , researchers might:

  • Conduct comparative functional genomics across laboratory strains and wild populations to identify natural variants of TMEM263 that might confer functional advantages or specializations.

  • Establish new experimental resources from genetically diverse wild populations, particularly from Nepal and Bangladesh which show the most genetic distinction .

  • Develop allele replacement strategies to introduce wild-type variants into laboratory strains for functional testing.

  • Examine evolutionary signatures in TMEM263 across populations to identify regions under selection, which may indicate functionally important domains.

This integrated approach would provide a more comprehensive understanding of TMEM263 biology beyond what can be achieved using standard laboratory strains alone.

What emerging technologies might advance our understanding of TMEM263 function in zebrafish?

Emerging technologies that could significantly advance our understanding of TMEM263 function include:

  • Single-cell transcriptomics and proteomics to map TMEM263 expression with unprecedented cellular resolution throughout development and in various tissues.

  • Optical control technologies such as optogenetics adapted for membrane protein regulation, allowing temporal control of TMEM263 function.

  • Live cell super-resolution microscopy to visualize TMEM263 dynamics in real-time, potentially revealing interactions with other cellular components.

  • Proximity labeling approaches (BioID, APEX) to identify the protein interaction network of TMEM263 in its native membrane environment.

  • Cryo-electron tomography for visualizing TMEM263 in its native membrane context at near-atomic resolution.

These technological approaches, applied within the zebrafish model system, would provide multidimensional insights into TMEM263 function that are currently inaccessible through conventional methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.