Recombinant Danio rerio UPF0458 protein C7orf42 homolog (zgc:103561)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tmem248; zgc:103561; Transmembrane protein 248
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
tmem248
Target Protein Sequence
MVLLLNPLENLKTYISNRPPLVIFMVSVSAVAIAFLTIGYFFKIKEIKSPEMTEDWNTFL LRFNEIDFCISENETLKHGLNESITPESTVTSSQTRSSTQSPPLLEDPGPINISVAITLT LDPLRPFGGYSRNITHLYASVLGQQVGLAGREAHEEMNITFTLPVAWNSDECVLHGRCEQ MVFSTCMTVTAASNVFPVTMQPPHCVPETYSNATSWYKIFTTARDSDTKYTQEYNPFWCY KGAIGKVYHTLNPKLTVIVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPGKVRQ NNPDFCQEKVALSAG
Uniprot No.

Target Background

Database Links

KEGG: dre:541403

UniGene: Dr.79167

Protein Families
TMEM248 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for working with this recombinant protein?

Optimal storage and handling of Recombinant Danio rerio UPF0458 protein C7orf42 homolog requires careful consideration of temperature, buffer composition, and aliquoting strategies to maintain protein stability and activity. The recommended protocol includes:

Storage ParameterRecommended ConditionNotes
Long-term storage-20°C to -80°CAliquoting necessary for multiple use
Working storage4°CFor up to one week
Storage bufferTris/PBS-based buffer, pH 8.0 with 6% TrehaloseFor lyophilized form
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening recommended
Cryoprotectant5-50% glycerol (final concentration)Default recommendation is 50%

Repeated freeze-thaw cycles should be strictly avoided as they can cause protein degradation and loss of activity . Prior to reconstitution, the vial should be briefly centrifuged to bring contents to the bottom. For long-term storage after reconstitution, adding glycerol as a cryoprotectant and dividing into single-use aliquots is essential to maintain protein integrity .

How can Recombinant Danio rerio UPF0458 protein C7orf42 homolog be effectively incorporated into zebrafish developmental studies?

Incorporating this recombinant protein into zebrafish developmental studies requires careful experimental design that leverages the unique advantages of the zebrafish model system. The transparent nature of zebrafish embryos allows for direct visualization of protein interactions when using fluorescently tagged versions of the protein .

A methodological approach includes:

  • Microinjection technique: The recombinant protein can be microinjected into one-cell stage zebrafish embryos using calibrated needles (typically 0.5-1 nL volume) with protein concentrations ranging from 50-200 ng/μL depending on experimental requirements .

  • Developmental timing considerations: Since zebrafish embryos develop rapidly outside the mother's body, protein introduction should be timed according to the developmental stage of interest. The protein should be prepared in a physiologically compatible buffer to prevent toxicity to embryos .

  • Co-localization studies: The recombinant protein can be used alongside fluorescent markers to track its distribution and interaction partners during development. This approach is particularly valuable for understanding the protein's role in specific developmental processes .

  • Comparative analysis with morpholino knockdown: To validate functional studies, researchers should compare protein overexpression effects with targeted knockdown using antisense morpholinos against the endogenous zgc:103561 gene .

The zebrafish model is particularly advantageous for these studies due to its rapid development, optical transparency, and genetic tractability, allowing researchers to observe the effects of the recombinant protein on developmental processes in real-time .

What are the recommended protocols for assessing protein-protein interactions involving this recombinant protein?

Investigating protein-protein interactions involving Recombinant Danio rerio UPF0458 protein C7orf42 homolog requires a multi-faceted approach that combines in vitro and in vivo techniques. The following methodological framework is recommended:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down the recombinant protein from lysates

    • Western blot analysis with antibodies against suspected interaction partners

    • Include appropriate negative controls (non-specific IgG and lysates from cells not expressing the protein)

    • Recommended lysis buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1% NP-40, with protease inhibitors

  • Proximity Ligation Assay (PLA):

    • For detecting interactions in fixed zebrafish tissue sections or cells

    • Requires specific antibodies against both the His-tag and the putative interacting protein

    • Signal amplification allows detection of low-abundance interactions

  • Yeast Two-Hybrid Screening:

    • Clone the full-length protein or specific domains into appropriate bait vectors

    • Screen against zebrafish cDNA libraries to identify novel interaction partners

    • Confirm interactions using reciprocal bait-prey configurations

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Generate fusion constructs with luciferase and fluorescent proteins

    • Monitor energy transfer in live cells as evidence of protein proximity

    • Calculate BRET ratios to quantify interaction strength

For membrane proteins like TMEM248, detergent selection is critical for maintaining native conformation during extraction. A comparison of detergent effectiveness is presented in the following table:

DetergentConcentrationExtraction EfficiencyPreservation of Interactions
Digitonin1%ModerateExcellent
DDM0.5-1%GoodGood
Triton X-1000.5-1%ExcellentModerate
CHAPS0.5-1%GoodGood

The choice of detergent should be optimized based on the specific experimental goals and the nature of the suspected interaction partners .

How can site-directed mutagenesis be used to investigate functional domains of the UPF0458 protein C7orf42 homolog?

Site-directed mutagenesis represents a powerful approach for elucidating the structure-function relationship of the UPF0458 protein C7orf42 homolog. Based on sequence analysis and predicted structural features, several key regions and residues can be targeted:

  • Transmembrane domain modifications:

    • The hydrophobic regions (residues 12-34, 231-253, and 267-289) predicted to span the membrane can be mutated to assess their role in protein localization and function

    • Substitution of hydrophobic residues with charged amino acids (e.g., leucine to arginine) can disrupt membrane insertion

    • Circular dichroism spectroscopy can confirm changes in secondary structure following mutations

  • Conserved motif analysis:

    • Sequence alignment across species reveals several conserved motifs, particularly in the 103-125 and 187-210 regions

    • Alanine scanning mutagenesis of these regions can identify critical residues for function

    • Point mutations should be introduced using PCR-based techniques with appropriate primers containing the desired mutations

  • Post-translational modification sites:

    • Bioinformatic analysis predicts potential phosphorylation sites at Ser-92, Thr-94, and Ser-97

    • These residues can be mutated to phosphomimetic (S/T→D/E) or phospho-null (S/T→A) variants

    • Functional consequences can be assessed through cellular localization studies and protein interaction assays

The following table outlines a systematic mutagenesis strategy:

Domain/MotifTarget ResiduesMutation TypeFunctional Analysis Method
TM1L19, F24, I26L→R, F→R, I→DMembrane localization assay
TM2F241, V244, M247F→R, V→E, M→KProtein stability assessment
TM3F271, L275, V282F→R, L→D, V→ETrafficking analysis
Conserved motif 1R107, N110, T115R→A, N→A, T→ACo-IP with known partners
Conserved motif 2W194, Y197, K203W→A, Y→A, K→AFunctional rescue assay
Phosphorylation sitesS92, T94, S97S/T→D (mimetic) S/T→A (null)Phosphorylation-dependent binding

After generating the mutants, they should be expressed and purified following the same protocol as the wild-type protein, and their functional properties should be comprehensively characterized and compared to the wild-type protein .

What are the current challenges and limitations in studying the function of UPF0458 protein C7orf42 homolog in zebrafish models?

Despite the advantages of zebrafish models for studying the UPF0458 protein C7orf42 homolog, several significant challenges and limitations must be considered when designing and interpreting experiments:

  • Functional redundancy challenges:

    • Zebrafish genome duplication events may have created paralogs with overlapping functions

    • Complete loss-of-function phenotypes may be masked by compensatory mechanisms

    • Solution approach: Employ CRISPR-Cas9 to generate multiple gene knockouts simultaneously and perform comprehensive paralog expression analysis

  • Protein expression and localization limitations:

    • The transmembrane nature of the protein complicates expression and purification

    • Antibody specificity issues for the zebrafish protein may limit immunodetection methods

    • Solution approach: Develop validated antibodies specifically for the zebrafish variant or use epitope-tagged versions for detection

  • Developmental timing considerations:

    • The rapid development of zebrafish (embryo to larvae in 72 hours) creates challenges for temporal protein function studies

    • Expression patterns may change dramatically across developmental stages

    • Solution approach: Implement inducible expression systems (e.g., heat shock promoters or Gal4/UAS systems) for temporal control

  • Technical challenges in membrane protein analysis:

    • Detergent-based extraction methods may disrupt native protein conformation and interactions

    • Hydrophobic nature complicates structural studies

    • Solution approach: Use mild detergents and native-like membrane environments (nanodiscs or liposomes) for functional studies

A comparison of current methodological approaches and their limitations is presented below:

MethodApplicationLimitationsPotential Solutions
Morpholino knockdownTransient loss-of-functionOff-target effects, limited to early developmentUse multiple morpholinos, include rescue controls
CRISPR-Cas9 knockoutPermanent gene disruptionPotential compensation, mosaic F0 phenotypesGenerate stable lines, analyze multiple founders
Recombinant protein injectionGain-of-function, rescueProtein stability, delivery efficiencyOptimize buffer conditions, use tissue-specific promoters
Live imaging of tagged proteinLocalization studiesTag interference with functionUse small tags, validate with untagged controls
In vitro binding assaysInteraction studiesArtificial conditionsValidate with in vivo methods

Addressing these challenges requires combining multiple complementary approaches and careful experimental design with appropriate controls to distinguish between direct and indirect effects of protein manipulation .

What methodological approaches can be used to study the role of UPF0458 protein C7orf42 homolog in zebrafish development and disease models?

The UPF0458 protein C7orf42 homolog can be studied in zebrafish development and disease models using a comprehensive methodological framework that combines genetic, molecular, and imaging approaches:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 genome editing: Generate precise mutations or complete knockouts of zgc:103561

      • Design guide RNAs targeting conserved exons (preferably exons 2-4)

      • Screen F0 founder fish using T7 endonuclease assay or direct sequencing

      • Establish stable transgenic lines through selective breeding

    • Transgenic overexpression: Create lines expressing wild-type or mutant versions under tissue-specific promoters

      • Use Tol2 transposon-based systems for efficient genomic integration

      • Employ the UAS-Gal4 system for conditional expression in specific tissues

  • High-resolution phenotypic analysis:

    • Light sheet microscopy: For real-time imaging of protein dynamics during development

      • Resolution: 0.5-1 μm spatial, 30 seconds temporal

      • Preparation: Mount embryos in 0.7-1.2% low-melting agarose

      • Analysis: Track protein movement and co-localization with cellular structures

    • Transgenic reporter lines: To visualize affected tissues and pathways

      • Cross mutant lines with relevant fluorescent reporters

      • Example reporters: Tg(fli1:EGFP) for vasculature, Tg(gata1:dsRed) for hematopoiesis

      • Quantitative analysis of reporter expression patterns

  • Disease modeling applications:

    • Chemical induction models: Test protein function under stress conditions

      • Exposure protocols: Continuous (0-5 dpf) or acute (specific developmental windows)

      • Concentration range: Typically 1-50 μM depending on compound

      • Analysis endpoints: Morphology, survival, gene expression, protein localization

    • Transplantation assays: For cell autonomy studies

      • Donor cells: Label with fluorescent dextran (10,000 MW)

      • Transplantation timing: Blastula stage (3-4 hpf)

      • Analysis: Track cell fate and behavior in wild-type or mutant environments

  • Molecular and biochemical techniques:

    • Temporal expression profiling: Determine developmental dynamics

      • qRT-PCR panel of developmental stages: 4-cell, shield, 24 hpf, 48 hpf, 72 hpf, 5 dpf

      • RNA-seq for comprehensive transcriptome analysis

      • Western blotting with stage-specific samples

The following table presents a systematic workflow for investigating protein function in disease models:

Disease ModelGenetic ApproachPhenotypic AnalysisMolecular AnalysisExpected Timeframe
Developmental disordersKnockout/knockdownMorphology scoring, organogenesis assessmentRNA-seq at key stages1-14 dpf
Neurological functionForebrain-specific expressionBehavioral testing, calcium imagingElectrophysiology, neurotransmitter analysis3-30 dpf
Vascular defectsEndothelial-specific manipulationVessel formation imagingFlow dynamics, permeability assays1-5 dpf
Regeneration modelsInducible expressionFin/heart regeneration assessmentProliferation markers, wound healing genes3-21 dpa

By integrating these approaches, researchers can develop a comprehensive understanding of the UPF0458 protein C7orf42 homolog's role in normal development and disease conditions, leveraging the unique advantages of the zebrafish model system .

What are the most common technical challenges when working with Recombinant Danio rerio UPF0458 protein and how can they be addressed?

Working with Recombinant Danio rerio UPF0458 protein presents several technical challenges that require specific troubleshooting approaches:

  • Protein solubility and aggregation issues:

    • Challenge: The transmembrane domains of UPF0458 protein can cause aggregation during expression and purification.

    • Solution: Optimize expression conditions using lower induction temperatures (16-20°C) and include solubility enhancers like 0.1% Triton X-100 or 0.5% CHAPS in purification buffers. Consider using fusion partners like MBP (maltose-binding protein) to enhance solubility .

  • Protein degradation during storage and handling:

    • Challenge: Proteolytic degradation can occur during storage or experimental procedures.

    • Solution: Add protease inhibitor cocktails during purification, store with 50% glycerol at -80°C in small aliquots, and validate protein integrity by SDS-PAGE before each experiment .

  • Inconsistent activity in functional assays:

    • Challenge: Variability in activity measurements across experiments.

    • Solution: Standardize protein concentration determination methods (BCA assay recommended), ensure proper folding through circular dichroism analysis, and include positive controls in each experimental batch .

  • Non-specific binding in interaction studies:

    • Challenge: High background signal in pull-down or immunoprecipitation experiments.

    • Solution: Increase stringency of wash buffers (150-300 mM NaCl gradient testing), pre-clear lysates with appropriate beads, and include competing agents like 0.1-0.5% BSA in binding reactions .

The following table provides a comprehensive troubleshooting guide for common issues:

ProblemPossible CausesDiagnostic ApproachSolution
Low protein yieldPoor expression, insolubilitySDS-PAGE analysis of total vs. soluble fractionsOptimize expression temperature (16-20°C), use solubility tags
Multiple bands on Western blotDegradation, non-specific antibody bindingTime-course stability test, alternative antibodiesAdd protease inhibitors, optimize antibody dilution
Loss of activity during storageFreeze-thaw damage, oxidationActivity assay before/after storageSingle-use aliquots, add reducing agents (DTT 1mM)
Precipitation upon buffer exchangeBuffer incompatibilitySystematic buffer screeningGradual dialysis, include stabilizers (10% glycerol)
Poor reproducibility in binding assaysVariable protein conformationCircular dichroism analysisStandardize purification protocol, verify proper folding

When troubleshooting, it's essential to change only one parameter at a time and document all conditions thoroughly to identify critical factors affecting protein behavior .

How should researchers design appropriate controls for experiments involving this recombinant protein?

Designing appropriate controls is crucial for experiments involving Recombinant Danio rerio UPF0458 protein C7orf42 homolog to ensure reliable and interpretable results. A systematic control strategy should include:

  • Protein-specific controls:

    • Denatured protein control: Heat-treated (95°C for 10 minutes) protein sample to serve as a negative control for structure-dependent functions

    • Tag-only control: Express and purify the His-tag portion alone to distinguish tag-mediated effects from protein-specific effects

    • Concentration-matched BSA control: Use equal concentrations of bovine serum albumin as a non-specific protein control

  • Genetic and functional controls:

    • Rescue experiments: When knocking down endogenous protein, confirm specificity by rescuing with recombinant protein resistant to knockdown

    • Inactive mutant control: Create a predicted non-functional mutant (e.g., by mutating conserved residues) as a negative control

    • Related protein control: Use a closely related but functionally distinct protein to demonstrate specificity

  • Experimental system controls:

    • Buffer-only controls: Include matched buffer components without protein to control for buffer effects

    • Untreated/wild-type controls: Maintain parallel wild-type samples without any protein treatment

    • Time-matched controls: Process control samples at identical timepoints to account for time-dependent variables

  • Validation controls:

    • Antibody validation: Confirm antibody specificity using western blots of wild-type vs. knockout samples

    • Cross-species validation: Test conserved function in multiple model systems when possible

    • Technical replicates: Perform at least three independent experimental replicates with freshly prepared protein

The following decision matrix helps determine appropriate controls based on experiment type:

Experiment TypeEssential ControlsRecommended Additional ControlsControl Analysis Method
Binding assaysNo-protein control, BSA control, His-tag onlyDose-response series, Competitor proteinsQuantitative comparison to baseline
Morpholino studiesMismatch morpholino, Rescue with recombinant proteinSecond non-overlapping morpholino, Cross-species rescueStatistical comparison of phenotype penetrance
Localization studiesUntransfected cells, Tag-only expressionSubcellular marker co-localization, Mutant localizationPearson's correlation coefficient
Functional assaysBuffer control, Inactive mutantDose-response, Time-courseANOVA with post-hoc analysis
In vivo studiesSham injection, Irrelevant proteinGenetic knockout validation, Tissue-specific rescueBlinded scoring of phenotypes

By implementing these control strategies, researchers can distinguish specific effects of the recombinant protein from experimental artifacts and establish the biological relevance of their findings .

What are the emerging applications and research opportunities for studying the UPF0458 protein C7orf42 homolog in zebrafish model systems?

The study of UPF0458 protein C7orf42 homolog in zebrafish presents several promising research frontiers that leverage technological innovations and biological insights:

  • Single-cell transcriptomics integration:

    • Apply single-cell RNA sequencing to identify cell populations expressing zgc:103561 across developmental stages

    • Map the co-expression networks to identify potential functional pathways

    • Combine with spatial transcriptomics to create 3D expression atlases during development

  • CRISPR screening applications:

    • Develop multiplexed CRISPR screens targeting interaction partners of UPF0458 protein

    • Use CRISPRi/CRISPRa systems for temporal control of gene expression

    • Apply base editing technologies for precise amino acid substitutions to study structure-function relationships

  • Organoid and ex vivo systems:

    • Establish zebrafish-derived organoid cultures expressing fluorescently tagged UPF0458 protein

    • Perform live imaging of protein dynamics in developing tissues

    • Test drug effects on protein function in physiologically relevant 3D environments

  • Cross-species functional conservation studies:

    • Compare function of zebrafish UPF0458 protein with mammalian orthologs

    • Develop humanized zebrafish models expressing human variants

    • Investigate evolutionary conservation of protein interaction networks

  • Disease modeling applications:

    • Create zebrafish models of human diseases linked to C7orf42/TMEM248 mutations

    • Perform high-throughput drug screening using these models

    • Validate findings through reverse translation to human cell models

The following table outlines specific research opportunities with associated methodological approaches:

Research DirectionKey TechnologiesExpected OutcomesPotential Impact
Membrane protein structural biologyCryo-EM, AlphaFold2 predictions3D structure of UPF0458 proteinStructure-guided drug design
Developmental signaling roleLight-sheet microscopy, optogeneticsDynamic protein function mapInsights into developmental disorders
Chemical biologyPROTAC technology, photocrosslinkingTargeted protein degradation toolsTherapeutic development
Systems biologyPhosphoproteomics, interactome mappingIntegration into signaling networksPathway-level understanding
Regenerative medicineLineage tracing, trauma modelsRole in tissue regenerationTherapeutic applications

These emerging research directions will benefit from the continued refinement of zebrafish genetic tools and imaging technologies, allowing unprecedented insights into the biological functions of this poorly characterized protein .

How can computational approaches enhance our understanding of the structure and function of UPF0458 protein C7orf42 homolog?

Computational approaches offer powerful tools for elucidating the structure and function of the UPF0458 protein C7orf42 homolog, particularly given the challenges of experimental characterization of membrane proteins. A multi-faceted computational strategy includes:

  • Advanced structural prediction methods:

    • AlphaFold2 and RoseTTAFold: Generate high-confidence structural models of the full-length protein

      • Prediction accuracy: Typically >90% for transmembrane topology prediction

      • Validation: Compare with experimental data from CD spectroscopy or limited proteolysis

    • Molecular dynamics simulations: Model protein behavior in membrane environments

      • Simulation parameters: 100-500 ns trajectories in POPC bilayers

      • Analysis: Conformational stability, lipid interactions, water accessibility

  • Evolutionary analysis approaches:

    • Sequence conservation mapping: Identify functionally important residues across species

      • Conservation scoring: ConSurf or Rate4Site algorithms

      • Visualization: Map conservation onto structural models to identify functional surfaces

    • Coevolution analysis: Detect coevolving residue pairs suggesting structural contacts

      • Methods: Direct Coupling Analysis (DCA) or Evolutionary Couplings analysis

      • Applications: Validate structural models, predict interaction interfaces

  • Network-based functional prediction:

    • Protein-protein interaction network analysis: Predict functional associations

      • Data integration: Combine experimental interactome data with predictive algorithms

      • Clustering: Identify functional modules containing UPF0458 protein

    • Gene co-expression networks: Identify co-regulated genes across developmental stages

      • Data sources: Zebrafish developmental transcriptome datasets

      • Analysis: Weighted gene correlation network analysis (WGCNA)

  • Machine learning approaches:

    • Function prediction: Train ML models on proteins with known functions to predict UPF0458 roles

      • Features: Sequence motifs, structural properties, expression patterns

      • Validation: Cross-validation against partial experimental data

    • Binding site prediction: Identify potential ligand binding pockets

      • Methods: Geometric analysis, conservation mapping, fragment docking

      • Output: Ranked list of potential binding sites with confidence scores

The following table summarizes computational methods and their applications:

Computational ApproachSoftware/ResourcesKey ParametersExpected Insights
Structural predictionAlphaFold2, RoseTTAFoldMSA depth >30 sequencesFull 3D structure, confidence per residue
Molecular dynamicsGROMACS, NAMD, Amber100-500 ns, CHARMM36 force fieldMembrane interactions, conformational changes
Sequence analysisHMMER, BLAST, ConSurfE-value cutoff 1e-10Functional domains, conserved motifs
Coevolutionary analysisEVcouplings, GREMLINMin. 500 diverse sequencesContact map validation, interaction interfaces
Network analysisSTRING, CytoscapeConfidence score >0.7Functional associations, pathway membership
Drug binding predictionAutoDock, RosettaEnergy scoring, ensemble dockingPotential binding pockets, drug interactions

Integration of these computational approaches with targeted experimental validation creates a powerful framework for understanding this poorly characterized protein, potentially revealing novel functions and therapeutic opportunities .

What are the key takeaways for researchers working with Recombinant Danio rerio UPF0458 protein C7orf42 homolog?

Researchers working with Recombinant Danio rerio UPF0458 protein C7orf42 homolog (zgc:103561) should consider several key principles and practical aspects to maximize experimental success and meaningful data generation:

  • Protein handling and stability considerations:

    • The protein requires careful storage conditions (-20°C to -80°C) with glycerol as a cryoprotectant

    • Single-use aliquots help maintain protein integrity by avoiding freeze-thaw cycles

    • Buffer optimization is critical for maintaining native conformation, especially for membrane proteins

  • Experimental design principles:

    • Comprehensive control strategies are essential for distinguishing specific protein effects

    • Multiple complementary approaches should be employed to validate findings

    • The unique advantages of zebrafish models (transparency, rapid development, genetic tractability) can be leveraged for in vivo studies

  • Technical recommendations:

    • Expression systems should be optimized for membrane proteins (lower temperature, specialized host strains)

    • Detergent selection critically impacts protein activity and interaction studies

    • Validation of protein quality (SDS-PAGE, circular dichroism) before experiments is essential

  • Functional characterization strategy:

    • Begin with localization studies to establish cellular context

    • Progress to interaction partner identification using multiple methods

    • Validate in vitro findings with in vivo functional studies in zebrafish models

  • Future research considerations:

    • Integrating computational predictions with experimental validation creates powerful insight

    • Cross-species comparison can reveal evolutionarily conserved functions

    • Disease relevance should be explored through appropriate zebrafish models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.