Recombinant Danio rerio UPF0668 protein C10orf76 homolog (zgc:63733)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Danio rerio UPF0668 protein C10orf76 homolog (zgc:63733) is a protein that, in humans, is encoded by the C10orf76 gene . It is a Danio rerio (zebrafish) protein produced in an in vitro E. coli expression system . The recommended name for this protein is UPF0668 protein C10orf76 homolog .

Basic Characteristics

CharacteristicDescription
Product CodeCSB-CF747484DIL
Uniprot No.Q6PGW3
Immunogen SpeciesDanio rerio (Zebrafish) (Brachydanio rerio)
SequenceMAQTEKKAGLLRRTSSSKKPLKEKVVLMYDEIFMKEDPTKNSPRFWDELFLMKVNLEYLEGKLESLDGDEFMKIKDNINSLFHHCVQALAEEHQIKVVNALQTLCALFRGVHQKNKSATGFDIINMLIGFDKAELRMKELMESLDSLLCGDGSESLKSLCLKLLLCLVTVTDNISQNTILEYVMINSIFEAILQILSDVSSRSQHGYDSVVLLALLVNYRKYESVNPYIVKLSIVDDEPTLDGLGMVIHHALTEYNRQYKEKEEENQGGFFSTLSSMVGSMFIADADEKLSVQTNEAILLALYEAVHLNRNFITVLAQSHPEIDMAATPATPVPASPTTPLGTTPPSLDLMNNPELPLDPNLQTSNLLITFLKYSSIVMQDTKDEHRLNSARLCLIILTCIAEDQYADAFLHDDNMNFRVNLHRMPMRHRKKAADKNIPCRPLVCAVLDLMVEFVVTHMMKEFPMDLYVRCVQIIHKLICYQKKCRVRLHYTWRELWSALINLLKFLLSNETGLLAKHNIFQLALQVVNLFNMFITYGDTFLPTPSSYDELYYEIIRMHQVFDNLYCMVLRVSTNAGQWKEPASKVTHALVNVRAIINHFNPKIESYAAVNHISQLSEDQVLEVVRSNYDTLTLKLQDGLDQFERYSEQPREAGFFKELVRSISLNVRKNVSLTTMSQDVLLKEFSSIS
SourceIn vitro E. coli expression system
Target Nameszgc:63733
Protein NamesUPF0668 protein C10orf76 homolog
Expression Region1-689
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein

Function and Localization

The protein is a transmembrane protein . The Danio rerio proteome was screened to identify proteins with a C-terminal peroxisomal targeting sequence (PTS1) .

Role in Zebrafish Development and Toxicology

Proteomic analysis in zebrafish embryos has been used to investigate the effects of environmental toxins such as perfluorooctane sulfonate (PFOS) . Studies like these have shown that PFOS exposure can alter the expression of proteins involved in detoxification, energy metabolism, lipid transport, cell structure, signal transduction, and apoptosis, providing insights into the molecular mechanisms of developmental toxicity .

Protein Requirements in Zebrafish

Studies have estimated the dietary protein requirement of juvenile zebrafish to be approximately 37.6% for maximum weight gain and 44.8% for maximum protein retention . Nutritional programming during juvenile stages can improve dietary plant protein utilization, affecting digestive hormone regulation and intestinal morphology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
armh3; zgc:63733; Armadillo-like helical domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
zgc:63733
Target Protein Sequence
MAQTEKKAGLLRRTSSSKKPLKEKVVLMYDEIFMKEDPTKNSPRFWDELFLMKVNLEYLE GKLESLDGDEFMKIKDNINSLFHHCVQALAEEHQIKVVNALQTLCALFRGVHQKNKSATG FDIINMLIGFDKAELRMKELMESLDSLLCGDGSESLKSLCLKLLLCLVTVTDNISQNTIL EYVMINSIFEAILQILSDVSSRSQHGYDSVVLLALLVNYRKYESVNPYIVKLSIVDDEPT LDGLGMVIHHALTEYNRQYKEKEEENQGGFFSTLSSMVGSMFIADADEKLSVQTNEAILL ALYEAVHLNRNFITVLAQSHPEIDMAATPATPVPASPTTPLGTTPPSLDLMNNPELPLDP NLQTSNLLITFLKYSSIVMQDTKDEHRLNSARLCLIILTCIAEDQYADAFLHDDNMNFRV NLHRMPMRHRKKAADKNIPCRPLVCAVLDLMVEFVVTHMMKEFPMDLYVRCVQIIHKLIC YQKKCRVRLHYTWRELWSALINLLKFLLSNETGLLAKHNIFQLALQVVNLFNMFITYGDT FLPTPSSYDELYYEIIRMHQVFDNLYCMVLRVSTNAGQWKEPASKVTHALVNVRAIINHF NPKIESYAAVNHISQLSEDQVLEVVRSNYDTLTLKLQDGLDQFERYSEQPREAGFFKELV RSISLNVRKNVSLTTMSQDVLLKEFSSIS
Uniprot No.

Target Background

Function

May be involved in Golgi maintenance and protein secretion.

Database Links
Protein Families
UPF0668 family
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What cloning strategies are most effective for zgc:63733 gene isolation?

For optimal isolation of the zgc:63733 gene from zebrafish, researchers should implement a targeted PCR-based approach beginning with high-quality RNA extraction from tissue samples where the gene is expressed. The recommended protocol involves total RNA isolation using STAT 60 or equivalent reagents, followed by cDNA synthesis using reverse transcriptase enzymes such as Superscript II. Gene-specific primers should be designed based on the zgc:63733 sequence, preferably using conserved regions identified through alignment with homologous sequences in databases like EMBL-EBI .

For amplification, high-fidelity DNA polymerases such as Phusion (Finnzymes) or Taq DNA polymerase (Invitrogen) should be employed according to manufacturer protocols. The amplified product can be cloned into an appropriate vector such as pGEM for sequence verification before subcloning into an expression vector . For optimal results, implement sequence verification at multiple stages to confirm the integrity of the cloned gene.

How should expression vectors be designed for optimal zgc:63733 production?

Expression vector selection for zgc:63733 should be based on careful consideration of the host organism, promoter characteristics, and inclusion of appropriate selection markers. For zebrafish protein expression, vectors containing constitutive promoters are suitable for continuous expression, while inducible promoters offer controlled, on-demand expression that can prevent potential toxicity issues .

The optimal expression vector design should include:

  • A strong promoter compatible with the chosen host system

  • Appropriate restriction sites flanking the multiple cloning site

  • Selection markers for stable transfection identification

  • Fusion tags to enhance protein solubility and facilitate purification

For inducible systems, consider promoters that respond to chemical inducers, temperature changes, or specific culture adjustments based on your experimental requirements. The selection between constitutive versus inducible expression should be determined by the specific characteristics of zgc:63733, particularly if preliminary data suggests potential toxicity when overexpressed .

What RNA extraction and cDNA synthesis protocols yield best results for zgc:63733 studies?

For zebrafish brain tissue, which likely expresses zgc:63733, homogenization in STAT 60 reagent followed by chloroform extraction produces high-quality RNA suitable for downstream applications. The recommended protocol includes:

  • Tissue homogenization in STAT 60

  • Phase separation with chloroform

  • RNA precipitation with isopropanol

  • Washing with 75% ethanol

  • Resuspension in RNase-free water

For cDNA synthesis, denature RNA samples at 70°C for 5 minutes, quickly chill on ice, and centrifuge briefly. Add reaction components for final concentrations of 1X reaction buffer, 10 mM DTT, and 20 U RNase inhibitor. Gently mix and heat at 42°C for 2 minutes before adding 200 U Superscript II RNase H- Reverse Transcriptase. Continue incubation at 42°C for 70 minutes followed by inactivation at 70°C for 10 minutes . Store completed cDNA at -20°C until use in PCR or other applications.

What methods confirm successful protein expression of recombinant zgc:63733?

Verification of successful recombinant zgc:63733 expression requires a multi-faceted approach. Western blotting with antibodies directed against the protein itself or against fusion tags (such as FLAG or His) provides the most direct confirmation of expression. Based on comparable zebrafish protein analysis, the predicted molecular weight of zgc:63733 should be determined beforehand to identify the correct band .

Immunofluorescence can confirm subcellular localization, while functional assays specific to the protein's predicted activity provide additional validation. For quantitative assessment, techniques such as ELISA or quantitative Western blotting with appropriate standards are recommended. For initial screening of multiple clones, high-throughput methods like dot blotting can identify promising candidates before more intensive characterization.

How can codon optimization enhance zgc:63733 expression in heterologous systems?

Codon optimization represents a sophisticated approach to enhance translation efficiency of zgc:63733 in heterologous expression systems. This process involves systematically modifying the genetic code of zgc:63733 to align with the codon usage preferences of the selected host organism without altering the amino acid sequence of the resulting protein .

The methodology for effective codon optimization includes:

  • Analysis of codon usage bias in the target expression system

  • Identification of rare codons in the zgc:63733 sequence

  • Replacement of rare codons with synonymous codons preferred by the host

  • Elimination of potential RNA secondary structures and cryptic splice sites

  • Adjustment of GC content to optimal levels for host expression

Researchers should avoid simply replacing all codons with the most frequent alternatives, as moderate codon rarity can sometimes benefit translation by introducing brief pauses that facilitate proper protein folding. Commercially available algorithms and services can assist with optimization design, but experimental validation of the optimized sequence is essential, as unexpected effects on expression levels may occur despite theoretical improvements .

What strategies address protein misfolding and aggregation during zgc:63733 production?

Protein misfolding and inclusion body formation represent significant challenges in recombinant protein production. For zgc:63733, which may be prone to these issues when expressed in heterologous systems, multiple approaches can be implemented:

  • Expression condition modification: Lower growth temperatures (15-25°C) slow translation rates, allowing more time for proper folding. Adjust inducer concentrations to moderate expression levels, preventing overwhelming of the host cell's folding machinery .

  • Co-expression of chaperones: Molecular chaperones like GroEL/GroES, DnaK/DnaJ/GrpE, or protein disulfide isomerases can significantly enhance proper folding of complex proteins.

  • Fusion partners: Solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin can be fused to zgc:63733 to improve folding and solubility .

  • Inclusion body recovery: When prevention strategies fail, inclusion bodies can be solubilized using chaotropic agents (6-8M urea or 4-6M guanidine hydrochloride) followed by gradual removal of the denaturant to allow refolding. This is often performed with additives like L-arginine or low concentrations of detergents to prevent reaggregation during refolding .

The optimal approach depends on the specific structural characteristics of zgc:63733 and should be determined empirically through systematic testing of multiple conditions.

How can RNAscope be applied to detect tissue-specific expression of zgc:63733?

RNAscope represents a powerful technique for detecting zgc:63733 transcript localization with cellular resolution in zebrafish tissues. Based on successful applications with other zebrafish genes, the following methodology is recommended:

  • Probe design: Custom RNAscope probes targeting zgc:63733 should be designed against unique regions of the transcript to ensure specificity. Validation in cell lines overexpressing the target gene is essential before tissue application .

  • Tissue preparation: Zebrafish tissues should be fixed in 4% paraformaldehyde, cryoprotected in sucrose, embedded in OCT compound, and sectioned at 10-12 μm thickness .

  • Hybridization protocol: Follow the manufacturer's protocol for the RNAscope Multiplex Fluorescent Reagent Kit with optimized pretreatment conditions for zebrafish tissues. Protease treatment times may require adjustment based on tissue type.

  • Validation and controls: Include positive control probes targeting housekeeping genes (e.g., actb) and negative control probes to verify assay performance. For colocalization studies, combine RNAscope with immunofluorescence for protein markers of specific cell types .

  • Signal amplification and detection: The branched DNA signal amplification system in RNAscope provides superior sensitivity and specificity compared to traditional in situ hybridization. Visualization can be performed using fluorescent or chromogenic detection systems .

This approach enables precise localization of zgc:63733 expression at the cellular level, facilitating correlation with functional studies and identification of tissue-specific regulatory mechanisms.

What approaches can characterize the functional properties of zgc:63733?

Comprehensive functional characterization of zgc:63733 requires multiple complementary approaches:

  • Bioinformatic analysis: Utilize BLAST, Pfam, and PANTHER databases to identify conserved domains and predict potential functions based on structural homology with characterized proteins. Molecular modeling using programs like Swiss-Model can generate structural predictions based on homologous proteins with known crystal structures .

  • Gene knockout/knockdown studies: Employ CRISPR/Cas9 or morpholino oligonucleotides to reduce or eliminate zgc:63733 expression in zebrafish, followed by phenotypic analysis to identify associated developmental or physiological defects.

  • Protein-protein interaction studies: Implement yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling techniques to identify interaction partners that may provide functional insights.

  • Subcellular localization: Determine the intracellular distribution of zgc:63733 through immunofluorescence or expression of fluorescently-tagged fusion proteins to correlate localization with potential functions .

  • Expression profiling: Analyze zgc:63733 expression patterns across developmental stages and tissues using qPCR, RNA-seq, or in situ hybridization to identify temporal and spatial regulation that may suggest functional roles .

The integration of these multiple approaches provides a comprehensive understanding of zgc:63733 function that extends beyond predictions based solely on sequence homology.

How does methylmercury exposure affect zgc:63733 expression in zebrafish?

While direct data on zgc:63733 response to methylmercury is not available, studies on gene expression changes in zebrafish brain following acute methylmercury exposure provide a methodological framework for investigating such effects. Researchers can adapt the following approach to examine zgc:63733-specific responses:

  • Exposure protocol: Inject adult zebrafish with environmentally relevant concentrations of methylmercury (0.5 μg MeHg/g) and maintain for 96 hours before tissue collection .

  • Tissue-specific expression analysis: Isolate brain tissue and extract RNA following established protocols. Perform quantitative PCR using zgc:63733-specific primers to assess expression changes relative to appropriate housekeeping genes .

  • Pathway analysis: Integrate zgc:63733 expression data with broader transcriptomic profiles using pathway analysis tools such as Pathway Studio to identify potential biological processes affected by methylmercury exposure .

  • Protein expression correlation: Complement transcript analysis with protein-level assessments using Western blotting or immunohistochemistry to determine if changes in mRNA levels translate to altered protein expression .

This systematic approach enables assessment of zgc:63733's potential role in neurotoxicological responses, particularly if the protein participates in cellular pathways implicated in mercury toxicity.

What methodologies can assess zgc:63733 involvement in blood-brain barrier function?

Given zebrafish homology to mammalian blood-brain barrier (BBB) systems, investigating potential roles of zgc:63733 in BBB function requires specialized approaches:

  • Co-localization studies: Utilize RNAscope to detect zgc:63733 transcripts in conjunction with established BBB markers such as claudin-5 and ZO-1. Dual labeling with immunofluorescence for endothelial markers can confirm expression in BBB-forming cells .

  • Transgenic reporter lines: Generate transgenic zebrafish expressing fluorescent proteins under the zgc:63733 promoter to visualize expression patterns in live animals, particularly focusing on brain vasculature.

  • Functional permeability assays: Following zgc:63733 knockdown or knockout, assess BBB integrity using tracer compounds of various molecular weights. Increased penetration of typically excluded tracers would suggest compromised barrier function .

  • Transport studies: If zgc:63733 is hypothesized to function as a transporter (similar to ABC transporters), conduct substrate specificity assays using fluorescent probes and flow cytometry as demonstrated for Abcb4 and Abcb5 characterization .

These methodologies provide comprehensive assessment of zgc:63733's potential involvement in BBB function, contributing to the understanding of zebrafish as a model for human BBB studies.

How can homology modeling inform functional predictions of zgc:63733?

Homology modeling represents a powerful approach for predicting the three-dimensional structure of zgc:63733 when experimental structures are unavailable. The methodology should follow these steps:

  • Template identification: Utilize BLAST or HHpred to identify structurally characterized homologs of zgc:63733 with sufficient sequence similarity (ideally >30%) to serve as templates.

  • Sequence alignment: Generate careful alignments between zgc:63733 and template sequences using programs like Clustal Omega, with manual refinement focusing on conserved motifs and secondary structure elements .

  • Model building: Employ modeling software such as Swiss-Model, MODELLER, or I-TASSER to generate structural models based on the template alignments. For zgc:63733, multiple templates may be required if different domains show homology to different proteins .

  • Model validation: Assess model quality using tools like PROCHECK, Verify3D, or MolProbity to identify regions of low confidence or structural irregularities.

  • Functional site prediction: Analyze the model for potential binding pockets, catalytic sites, or protein-protein interaction interfaces using CASTp, COACH, or similar programs .

  • Comparative analysis: If zgc:63733 belongs to a protein family, compare models with known structures of family members to identify conserved and divergent structural features that may indicate functional specialization.

The resulting structural model can guide experimental design, including site-directed mutagenesis of predicted functional residues and rational design of inhibitors or activators for functional validation studies.

What cell-based assays can determine subcellular localization and trafficking of zgc:63733?

Determining the subcellular localization of zgc:63733 is crucial for understanding its function. The following methodological approaches are recommended:

  • Fluorescent fusion proteins: Generate constructs expressing zgc:63733 fused to fluorescent proteins (GFP, mCherry) at either N- or C-terminus. Express these in appropriate cell lines (HEK293, zebrafish cell lines) and visualize using confocal microscopy .

  • Organelle co-localization: Combine fluorescent zgc:63733 visualization with organelle-specific markers (MitoTracker, ER-Tracker, LysoTracker) or co-transfection with fluorescently-tagged organelle markers to determine precise subcellular distribution.

  • Immunofluorescence microscopy: For endogenous protein detection, develop antibodies against zgc:63733 or use epitope-tagged versions (FLAG, HA) when antibodies aren't available. The methodology should follow validated immunofluorescence protocols with appropriate controls .

  • Biochemical fractionation: Complement imaging approaches with subcellular fractionation followed by Western blotting to detect zgc:63733 in isolated organelle fractions.

  • Trafficking studies: For dynamic assessment of protein trafficking, implement photoactivatable fluorescent fusion proteins or fluorescence recovery after photobleaching (FRAP) to track movement between cellular compartments .

These complementary approaches provide comprehensive characterization of zgc:63733 localization, offering insights into potential function based on its cellular distribution.

How should quantitative PCR data for zgc:63733 expression be normalized and analyzed?

Accurate quantification of zgc:63733 expression requires rigorous normalization and statistical analysis. The recommended methodology includes:

  • Reference gene selection: Validate multiple candidate reference genes (e.g., ef1α, rpl13α, actb) under experimental conditions using tools like geNorm or NormFinder to identify the most stable references for normalization .

  • Primer validation: Confirm zgc:63733 primer specificity through melt curve analysis and agarose gel electrophoresis. Determine amplification efficiency using standard curves with serial dilutions of template (acceptable range: 90-110%) .

  • Experimental design: Include minimum three biological replicates and two technical replicates per condition. Incorporate no-template and no-reverse-transcriptase controls to detect contamination or genomic DNA amplification .

  • Data analysis: Calculate relative expression using the 2^(-ΔΔCt) method when amplification efficiencies are similar between target and reference genes, or efficiency-corrected models when they differ .

  • Statistical evaluation: Apply appropriate statistical tests (t-test for two groups, ANOVA for multiple groups) after confirming data normality. For non-normal distributions, use non-parametric alternatives such as Mann-Whitney U test or Kruskal-Wallis test .

This comprehensive approach ensures reliable quantification of zgc:63733 expression changes in response to experimental conditions or across developmental stages.

What bioinformatic pipelines integrate zgc:63733 expression with broader pathway analyses?

Integrating zgc:63733 expression data within broader biological contexts requires sophisticated bioinformatic approaches:

  • Pathway enrichment analysis: Convert zebrafish gene identifiers to human homologs using tools like NCBI Homologene or manually retrieving RefSeq identifiers. Enter these into pathway analysis software such as Pathway Studio, KEGG, or Ingenuity Pathway Analysis to identify enriched biological processes .

  • Co-expression network analysis: Implement WGCNA (Weighted Gene Co-expression Network Analysis) to identify genes with expression patterns correlated with zgc:63733, potentially revealing functional associations not evident from sequence-based predictions.

  • Interactome mapping: Predict protein-protein interactions using tools like STRING or PrePPI, integrating homology-based predictions with experimental data from model organisms .

  • Multi-omics integration: Combine transcriptomic data with proteomics or metabolomics datasets using joint pathway analysis tools like MetaboAnalyst or mixOmics to obtain comprehensive biological insights.

  • Visualization: Present integrated data using tools like Cytoscape with appropriate plugins (e.g., ClueGO, EnrichmentMap) to create informative network visualizations that highlight relationships between zgc:63733 and connected pathways .

This systematic integration approach positions zgc:63733 within its broader biological context, generating testable hypotheses about its functional roles and regulatory relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.