Recombinant Danio rerio UPF0708 protein C6orf162 homolog (si:busm1-189a20.6, si:ch211-241J12.5, zgc:112287)

What is the basic characterization of UPF0708 protein C6orf162 homolog in zebrafish?

The UPF0708 protein C6orf162 homolog in Danio rerio (zebrafish) is a small integral membrane protein (smim8) consisting of 104 amino acids with the sequence: MSSGQSSSSSGKAGPQEPPSSAAEPAYRSPGLRGVRTTSLFRAVNPELFIRPNKPVMALG LLALSVCVGYLGYLHAIRDSDQQLYEAVDSDGETYMRRRTSRWD . It has a UniProt ID of Q502E5 and is identified by several alternative names including si:busm1-189a20.6, si:ch211-241J12.5, and zgc:112287 . The protein contains transmembrane domains, suggesting its localization within cellular membranes. The "UPF" designation indicates it belongs to an uncharacterized protein family, with potential homology to the human C6orf162 protein. Within the broader research context, this protein is significant as zebrafish and human genomes share approximately 70% homology, making it potentially relevant for understanding conserved genetic pathways .

What expression systems are recommended for recombinant production of this protein?

For recombinant production of Danio rerio UPF0708 protein, E. coli has been demonstrated as an effective expression system for producing full-length protein (amino acids 1-104) . The protein can be successfully expressed with an N-terminal His-tag to facilitate purification . When scaling up production, researchers should consider these methodological approaches:

• Bacterial expression (E. coli): Suitable for initial characterization and high-yield production, especially when using His-tagged constructs

• Mammalian expression systems: For studies requiring proper post-translational modifications, HEK293 cells grown in suspension can provide appropriate folding environments, particularly important for transmembrane proteins

• Insect cell expression: An alternative eukaryotic system that may provide advantages for membrane protein production

The choice of expression system should be guided by downstream applications, with bacterial systems offering cost-effective high yields, while mammalian systems may provide more physiologically relevant modifications for functional studies .

What are the optimal storage and handling recommendations for this recombinant protein?

Optimal storage and handling of recombinant UPF0708 protein C6orf162 homolog requires specific conditions to maintain stability and functionality:

Researchers should avoid repeated freeze-thaw cycles as they significantly compromise protein integrity . For experimental work requiring repeated access, prepare multiple small aliquots during initial reconstitution rather than repeatedly freezing and thawing a single stock . Centrifuge vials briefly before opening to ensure all material is collected at the bottom of the tube .

What experimental approaches are recommended for studying UPF0708 protein function in zebrafish models?

When investigating UPF0708 protein function in zebrafish models, researchers can employ several complementary approaches:

• mRNA injection: For transient expression studies, inject synthesized mRNA encoding UPF0708 protein into one-cell stage embryos. This approach allows for rapid protein expression and functional analysis during early developmental stages . For mosaic expression analysis, inject into a single blastomere at the 8-cell stage .

• In situ hybridization: To characterize endogenous expression patterns, develop antisense mRNA probes targeting UPF0708 transcripts. Both chromogenic and fluorescent detection methods can be employed, with the latter enabling simultaneous detection of multiple targets (up to five with HCR amplification) .

• Transgenic approaches: For stable expression studies, consider developing transgenic lines using systems like Cre-recombinase under heat-shock promoters coupled with GAL4/UAS systems. This allows for inducible expression at defined developmental timepoints .

• Behavioral assays: Since zebrafish are used to model various neuropsychiatric conditions, behavioral testing (swimming patterns, locomotion, exploratory behavior) can potentially reveal phenotypes associated with UPF0708 protein function or dysfunction .

• Morpholino knockdown: To assess loss-of-function phenotypes, morpholino oligonucleotides can be designed to target UPF0708 mRNA, though results should be validated using complementary approaches due to potential off-target effects .

These methods can be tailored based on specific research questions, with particular attention to developmental timing when studying membrane proteins that may have stage-specific functions.

How can researchers effectively design functional assays to characterize this relatively uncharacterized protein?

Designing functional assays for an uncharacterized protein like UPF0708 requires a systematic approach:

• Bioinformatic analysis: Begin with in silico characterization using tools to predict:

  • Subcellular localization based on transmembrane domains

  • Potential protein-protein interaction motifs

  • Conserved functional domains across species

  • Structural homology to characterized proteins

• Localization studies: Generate fluorescently tagged constructs (e.g., GFP-UPF0708) to determine subcellular localization in zebrafish cells or tissues. This provides initial insights into potential functional compartments .

• Interactome analysis: Perform co-immunoprecipitation followed by mass spectrometry to identify binding partners, which can suggest functional pathways .

• Gene expression analysis: Compare transcriptional profiles between wild-type and UPF0708-manipulated zebrafish to identify affected pathways through RNA-seq or qPCR of candidate genes .

• Phenotypic screening: Systematically evaluate developmental, morphological, and behavioral phenotypes following UPF0708 overexpression or knockdown, particularly focusing on:

  • Craniofacial development (relevant to models of Treacher Collins syndrome, CHARGE syndrome)

  • Neurological function (zebrafish are established models for neuropsychiatric diseases)

  • Membrane protein trafficking and organization

Integrating these diverse approaches provides complementary lines of evidence that collectively illuminate protein function, even in the absence of prior characterization.

What purification strategies yield the highest purity and biological activity for this protein?

For optimal purification of recombinant UPF0708 protein C6orf162 homolog, researchers should implement a multi-step strategy:

• Initial capture: For His-tagged constructs, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins as the primary purification step . Optimize imidazole concentrations in washing and elution buffers to balance purity with yield.

• Secondary purification: Follow with size exclusion chromatography to separate monomeric protein from aggregates and remove any remaining contaminants. For a 104-amino acid protein, a Superdex 75 or equivalent column would be appropriate .

• Quality control assessment: Verify purity using SDS-PAGE (aim for >90% purity) and Western blotting with anti-His antibodies. Additionally, mass spectrometry can confirm protein identity and detect any post-translational modifications.

• Functional verification: Since this is a membrane protein, consider reconstitution into nanodiscs or liposomes to maintain native-like membrane environment, which may be crucial for proper folding and function .

• Activity preservation: During concentration steps, avoid excessive centrifugal force that might cause protein aggregation. Use gentle methods like dialysis against polyethylene glycol for volume reduction of membrane proteins.

The purification protocol should be optimized based on downstream applications, with particular attention to detergent selection if membrane protein activity is to be preserved in solution.

How can CRISPR-Cas9 technology be applied to study UPF0708 protein C6orf162 homolog function in zebrafish?

CRISPR-Cas9 technology offers powerful approaches for investigating UPF0708 protein function in zebrafish through these methodological strategies:

• Gene knockout models: Design sgRNAs targeting critical exons of the UPF0708 gene to generate frameshift mutations and premature stop codons. For transmembrane proteins, targeting domains responsible for membrane insertion is particularly effective . Inject Cas9 protein complexed with sgRNAs into one-cell stage embryos, then screen F0 mosaic embryos for phenotypes before establishing stable lines.

• Precise point mutations: Employ homology-directed repair (HDR) by co-injecting Cas9-sgRNA complexes with a repair template containing desired mutations. This approach is valuable for studying specific domains or post-translational modification sites within the UPF0708 protein.

• Endogenous tagging: Create fusion proteins by inserting fluorescent reporters or epitope tags at the C-terminus or N-terminus of the endogenous UPF0708 gene, enabling visualization of native expression patterns and protein localization without overexpression artifacts .

• Conditional knockouts: Implement tissue-specific or temporally controlled gene deletion using Cre-loxP systems combined with CRISPR-mediated insertion of loxP sites, especially useful for studying proteins that may have embryonic lethal phenotypes when constitutively deleted.

• Transcriptional modulation: Deploy CRISPRa (activation) or CRISPRi (interference) systems to modulate UPF0708 expression levels without altering the genomic sequence, providing insights into dosage-sensitive functions.

These approaches should be validated through sequencing of genomic modifications and careful phenotypic analysis across multiple founder lines to control for off-target effects.

What strategies can researchers employ to investigate potential protein-protein interactions involving UPF0708 protein?

To comprehensively characterize protein-protein interactions (PPIs) involving UPF0708 protein, researchers should implement complementary approaches:

• Proximity labeling technologies:

  • BioID or TurboID: Fuse biotin ligase to UPF0708 protein to biotinylate proximal proteins, followed by streptavidin pulldown and mass spectrometry identification

  • APEX2: Use peroxidase-based proximity labeling for rapid biotin tagging of neighboring proteins
    These methods are particularly valuable for transmembrane proteins like UPF0708 that may have transient interactions

• Co-immunoprecipitation (Co-IP):

  • Standard Co-IP with tagged UPF0708 protein expressed in zebrafish embryos or relevant cell lines

  • Crosslinking-assisted Co-IP to capture transient interactions

  • Reverse Co-IP using antibodies against predicted interacting partners

• Yeast two-hybrid screening:

  • Split the UPF0708 protein into domains and screen against zebrafish cDNA libraries

  • Consider membrane yeast two-hybrid systems optimized for transmembrane proteins

• Fluorescence-based interaction assays:

  • Förster resonance energy transfer (FRET) between UPF0708 and candidate interactors

  • Bimolecular fluorescence complementation (BiFC) in zebrafish cells or transgenic embryos

  • Fluorescence correlation spectroscopy to detect complex formation in live cells

• In silico prediction followed by validation:

  • Use computational tools to predict interactions based on structural homology

  • Validate top candidates using biochemical or genetic approaches

Integration of multiple methodologies provides higher confidence in identified interactions, with particular attention to controlling for nonspecific binding and validation across different experimental contexts.

How can researchers investigate the comparative differences between zebrafish UPF0708 protein and its human homolog?

Investigating comparative differences between zebrafish UPF0708 protein and its human homolog requires a multi-faceted approach:

• Sequence and structural analysis:

  • Perform pairwise sequence alignment to identify conserved domains and divergent regions

  • Conduct phylogenetic analysis including homologs from other model organisms

  • Generate homology models of both proteins to compare predicted structural features

  • Analyze conservation of post-translational modification sites

• Expression pattern comparison:

  • Map spatial and temporal expression patterns in zebrafish using in situ hybridization

  • Compare with human expression data from tissue atlases

  • Analyze expression in disease contexts across both species

• Functional complementation studies:

  • Express human UPF0708 homolog in zebrafish UPF0708 knockouts to assess functional conservation

  • Evaluate rescue of any identified phenotypes

  • Test domain-swapping constructs to identify functionally critical regions

• Interactome comparative analysis:

  • Identify interaction partners for both zebrafish and human proteins

  • Compare interactomes to determine conserved and species-specific interactions

  • Assess conservation of signaling pathways involving these proteins

• Leveraging zebrafish disease models:

  • Evaluate the zebrafish UPF0708 protein's role in models relevant to human disorders

  • Particularly focus on neuropsychiatric and developmental disorder models where zebrafish have established validity

  • Assess if human disease-associated variants affect protein function when introduced to the zebrafish ortholog

This comparative approach leverages the 70% homology between zebrafish and human genomes to identify both conserved mechanisms and species-specific adaptations, providing insights into the potentially conserved functions of this uncharacterized protein family.

What are common challenges in recombinant expression of UPF0708 protein and how can they be addressed?

Researchers working with recombinant UPF0708 protein C6orf162 homolog may encounter several challenges during expression and purification:

For membrane proteins like UPF0708, special consideration should be given to detergent selection during solubilization and purification. A detergent screen (ranging from harsh ionic detergents to milder non-ionic options) can identify optimal conditions for extracting functional protein from membranes while maintaining native structure .

How can researchers validate antibodies and develop immunodetection methods for UPF0708 protein?

Developing reliable immunodetection methods for UPF0708 protein requires systematic antibody validation:

• Antibody development strategy:

  • Generate antibodies against multiple epitopes across the UPF0708 protein

  • Consider both N-terminal and C-terminal regions for antibody targets

  • Develop antibodies against unique peptide sequences not conserved in related proteins

• Validation experiments:

  • Positive controls: Test against recombinant UPF0708 protein with known concentration gradients

  • Specificity controls: Evaluate cross-reactivity with related proteins or in knockout models

  • Application testing: Validate antibodies in multiple applications (Western blot, immunohistochemistry, immunoprecipitation)

• Western blot optimization:

  • Determine optimal sample preparation conditions (detergent type and concentration)

  • Establish appropriate blocking agents to minimize background

  • Fine-tune antibody concentration and incubation conditions

  • For membrane proteins, avoid boiling samples which may cause aggregation

• Immunohistochemistry/immunofluorescence protocol development:

  • Compare fixation methods (PFA, methanol) for optimal epitope preservation

  • Test various antigen retrieval techniques if necessary

  • Establish proper permeabilization conditions for accessing intracellular epitopes

  • Validate with colocalization studies using known membrane markers

• Epitope tagging alternatives:

  • Generate zebrafish lines expressing tagged versions of UPF0708 (FLAG, HA, etc.)

  • Use well-characterized commercial antibodies against these tags

  • Confirm that tags do not interfere with protein localization or function

Proper validation should include demonstration of antibody specificity, sensitivity, reproducibility, and appropriate application in the experimental contexts of interest.

What are promising research directions for understanding UPF0708 protein's role in zebrafish development and disease models?

Several promising research directions exist for elucidating UPF0708 protein's functional significance:

• Developmental biology investigations:

  • Characterize temporal and spatial expression patterns during embryogenesis

  • Analyze potential roles in zebrafish craniofacial development, as zebrafish models exist for conditions like Treacher Collins syndrome and CHARGE syndrome that involve craniofacial abnormalities

  • Investigate potential functions in neural development, given zebrafish utility in modeling neuropsychiatric conditions

• Disease modeling applications:

  • Explore potential roles in neurodevelopmental disorders, leveraging zebrafish models of autism spectrum disorders and schizophrenia

  • Investigate involvement in Parkinson's disease pathways, as zebrafish have been established as models for studying neuronal cell death in early-onset PD

  • Examine potential connections to environmental toxin response, building on studies of silica nanoparticle neurotoxicity in zebrafish

• Cellular function explorations:

  • Characterize subcellular localization and trafficking of UPF0708 protein

  • Investigate potential roles in membrane organization or cellular signaling

  • Explore functions in specific cell types through single-cell transcriptomics and proteomics

• Molecular mechanism studies:

  • Identify protein interaction networks through proximity labeling approaches

  • Characterize potential roles in cellular stress responses

  • Investigate structural determinants of function through targeted mutagenesis

These research directions leverage the established advantages of zebrafish models while addressing the significant knowledge gap regarding this uncharacterized protein family, potentially revealing conserved functions relevant to human health and disease.

How can emerging technologies enhance the study of UPF0708 protein function and interactions?

Emerging technologies offer exciting opportunities to advance understanding of UPF0708 protein:

• Advanced imaging approaches:

  • Super-resolution microscopy techniques (STED, PALM, STORM) to visualize UPF0708 localization with nanometer precision

  • Lattice light-sheet microscopy for dynamic tracking of protein movements in living zebrafish embryos

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural context

• Single-cell multi-omics integration:

  • Single-cell proteomics to identify cell-type-specific expression patterns

  • Spatial transcriptomics to map expression within tissue contexts

  • Multi-modal data integration connecting genomic, transcriptomic, and proteomic layers

• Protein structure determination:

  • Cryo-electron microscopy for membrane protein structural analysis

  • AlphaFold2 and related AI approaches for structure prediction

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

• Genome engineering advances:

  • Base editing and prime editing for precise genomic modifications

  • Multiplexed CRISPR screens to identify genetic interactions

  • Optical control of gene expression (optogenetics) for spatiotemporal manipulation

• Functional screening platforms:

  • Automated behavioral phenotyping of zebrafish larvae

  • High-content imaging for morphological and subcellular phenotypes

  • Drug screening platforms to identify compounds affecting UPF0708 function

These technologies, when applied systematically, can accelerate understanding of UPF0708 protein beyond what traditional approaches might achieve in isolation, particularly for challenging targets like transmembrane proteins where conventional methods may have limitations.