Recombinant Danio rerio UPF0766 protein C6orf228 homolog (si:dkey-206d17.5)
Shipped with Ice Packs 
In Stock 
Description
Basic Properties
| Parameter | Value |
|---|---|
| UniProt ID | B8JJV5 |
| Gene Name | smim13; si:dkey-206d17.5 |
| Sequence Length | Full-length (1–88 amino acids) |
| Molecular Weight | ~9,983 Da |
| Amino Acid Sequence | MWQSVGLTVLVIVATLICVLLFMLFGWYVVWQLFLSKFKFLRELVGDTGSPQAETEPSES ESERSSPPTPRQRPKTARQRVIPPDSTT |
| Tag | N-terminal His-tag (10xHis) |
This protein is expressed as a recombinant product in E. coli with a purity exceeding 90% as determined by SDS-PAGE .
Production System
Purification
Functional Studies
-
Gene Homology: Serves as a model for studying the role of UPF0766 family proteins in cellular processes, including membrane trafficking or signaling .
-
Immunoassays: Used as an antigen in ELISA kits (e.g., CSB-CF493478DIL) .
Recommendations
Key Vendors
| Vendor | Product Code | Format | Price (USD) |
|---|---|---|---|
| Creative Biomart | RFL21456DF | Lyophilized powder | Not listed |
| Cusabio | CSB-CF493478DIL | Lyophilized/liquid | ~$1,428 |
| MyBiosource | MBS7037254 | Lyophilized | $1,500–$11,615 |
Note: Prices vary based on batch size and customization options .
Potential Roles
-
Membrane Function: Likely involved in transmembrane signaling or transport pathways, given its hydrophobic domains and homology to C6orf228 .
-
Developmental Studies: Zebrafish models may use this protein to explore embryonic development or disease-related pathways .
Challenges
Product Specs
Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include this information in your order remarks. We will then prepare the product according to your requirements.
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include this information in your order remarks. We will then prepare the product according to your requirements.
Lead Time
The delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery details.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We advise briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
smim13; si:dkey-206d17.5; Small integral membrane protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-88
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
smim13
Target Protein Sequence
MWQSVGLTVLVIVATLICVLLFMLFGWYVVWQLFLSKFKFLRELVGDTGSPQAETEPSES
ESERSSPPTPRQRPKTARQRVIPPDSTT
Uniprot No.
Target Background
Database Links
KEGG: dre:100190889
UniGene: Dr.81807
Protein Families
SMIM13 family
Subcellular Location
Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
