Recombinant Danio rerio Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (vma21)

Recombinant Danio rerio vacuolar ATPase assembly integral membrane protein VMA21 (vma21) is a bioengineered protein derived from zebrafish, designed to study the assembly and function of the vacuolar ATPase (V-ATPase) complex. This protein is critical for lysosomal acidification, autophagy regulation, and cellular homeostasis. The recombinant form is His-tagged, expressed in E. coli, and spans amino acids 1–104, corresponding to the full-length native protein (UniProt: B8JLV7) .

Domain Architecture

VMA21 is an integral membrane protein with two transmembrane domains and a luminal loop. It interacts with V-ATPase subunits (e.g., ATP6V0C) to facilitate the assembly of the V₀ domain, a process essential for proton translocation into lysosomes . The recombinant zebrafish version retains these structural features, enabling functional studies in heterologous systems.

FeatureDescriptionSource
Protein Length104 amino acids (1–104)
Expression SystemE. coli
TagN-terminal His tag
FunctionChaperones V₀ domain assembly; escorts V₀ to the Golgi for V1 domain binding

Role in Disease Modeling

Mutations in vma21 cause X-linked myopathy with excessive autophagy (XMEA), characterized by lysosomal dysfunction and autophagic vacuoles. A zebrafish model (vma21 mutants) recapitulates XMEA phenotypes, including impaired lysosomal acidification, reduced Lamp1 staining, and autophagic flux disruption . The recombinant protein may aid in studying these mechanisms or testing therapeutic interventions.

Mechanistic Insights

  • Lysosomal Acidification: VMA21 deficiency leads to neutral lysosomes, as shown by LysoTracker Red staining failure in vma21 mutants .

  • Autophagy Dysregulation: Mutant zebrafish exhibit increased LC3-II levels and autophagic vacuoles, indicative of stunted autophagic flux .

  • Hepatic Pathology: vma21 mutants develop lipid deposition and reduced liver size, mimicking human hepatic steatosis linked to VMA21 defects .

Table 1: Key Experimental Observations in Zebrafish Models

PhenotypeObservationSource
Lysosomal AcidificationAbsence of LysoTracker Red staining in vma21 mutants
Motor FunctionReduced swim velocity and touch-evoked escape response in mutants
Liver PathologyHepatic steatosis and bile flux impairment

Table 2: Functional Interactions of VMA21

Interaction PartnerRole in V-ATPase AssemblySource
ATP6V0CSubunit of the V₀ domain; binds VMA21 during proteolipid ring formation
ATP6AP2ER chaperone; interacts with VMA21 to mediate V₀ assembly

Therapeutic Implications

In zebrafish models, compounds like edaravone (antioxidant) and LY294002 (PI3K inhibitor) improved motor function and survival, suggesting potential therapeutic targets for XMEA . The recombinant protein could facilitate high-throughput screening for small-molecule modulators of VMA21 activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vma21; si:ch73-26o5.1; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
vma21
Target Protein Sequence
MQNYDKKEVGSVPGAMPDFRGNDGSLVSVLKTLLFFTILMITLPIGLYFTSKSLLFEATL GYSSNDSYFYAAILAVLAVHVVLALFVYVAWNEGSRQWREGKQD
Uniprot No.

Target Background

Function

Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.

Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.