Recombinant Danio rerio Vacuole membrane protein 1 (vmp1)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

Recombinant Danio rerio VMP1 is expressed in multiple systems, including E. coli, Baculovirus, and Yeast, with variations in post-translational modifications and yields . Key specifications include:

VMP1 is a multifunctional protein implicated in:

Autophagy Regulation

  • Facilitates autophagosome formation and lysosomal fusion, essential for cellular homeostasis .

  • Modulates ER calcium levels via interactions with SERCA pumps, impacting protein folding and signaling .

Lipid Metabolism and Secretion

  • Governs lipoprotein secretion by enabling ER-to-Golgi transport of lipid particles .

  • Depletion in zebrafish models causes hepatic steatosis and impaired VLDL secretion, mimicking human NAFLD/NASH pathologies .

Organelle Biogenesis

  • Critical for biogenesis of secretory organelles (e.g., rhoptries in apicomplexan parasites) and lipid droplet formation .

Research Applications

Recombinant Danio rerio VMP1 is utilized in:

Table 2: Key Research Applications

ApplicationExperimental ModelFindings
Autophagy mechanisms Zebrafish hepatocytesVMP1 knockout disrupts autophagic flux .
Lipid metabolism studies In vitro hepatoma cellsImpaired VLDL secretion under VMP1 deficiency
Structural biology AlphaFold modelingConserved DedA domain architecture .
Disease modeling NAFLD/NASH mouse modelsHepatic VMP1 loss induces steatosis .

Pathophysiological and Therapeutic Insights

  • Cancer: VMP1 overexpression correlates with glioma progression and chemoresistance, making it a prognostic biomarker .

  • Infectious Diseases: Apicomplexan parasites (e.g., Plasmodium, Toxoplasma) require VMP1 for organelle function and virulence, highlighting its potential as a drug target .

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of VMP1 could ameliorate NAFLD/NASH or combat apicomplexan infections .

  • Structural Studies: Cryo-EM analysis of recombinant VMP1 may elucidate lipid scramblase mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for precise delivery timeframe.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
vmp1; Vacuole membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MAANGAECEQPQKRLGPKDKQNGSSTDSSLRERKQLDREERLSLVLWKRPFITLQYFFLE TAITLKEWTWKLWQRRGVVFLTVVLFSLFSLAYSIEGAHQEYVQHLEKKFLWCAYWVGLG ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECGSVNFPEPPYPAQIVCPEDEALQESISL WTIMSKVRLEACMWGAGTAIGELPPYFMARAARMSGADPDDEDYEEFEEMLEHSQSAQDF ASRAKLAVQNMVQKVGFFGILACASIPNPLFDLAGITCGHFLIPFWTFFGATLIGKAIIK MHIQKLFVIITFSKHIVEQMVSLIGVIPGVGASLQKPFREYLEAQRTKLHNPAGDGAAAG ESWLSWVFEKVVLVMVCYFILSIINSMAQSYAKRLQQKKYSEEKTK
Uniprot No.

Target Background

Function
Vacuole membrane protein 1 (VMP1) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics processes. It exhibits phospholipid scramblase activity toward cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. VMP1 is essential for autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane by re-equilibrating the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B). This process facilitates autophagosome assembly. In addition to autophagy, VMP1 is involved in other processes requiring phospholipid scramblase activity. It modulates ER contacts with lipid droplets, mitochondria, and endosomes.
Database Links

KEGG: dre:336789

STRING: 7955.ENSDARP00000004153

UniGene: Dr.982

Protein Families
VMP1 family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Vacuole Membrane Protein 1 (vmp1) in Danio rerio?

Vacuole membrane protein 1 (vmp1) in Danio rerio is a multispanning membrane protein localized in the endoplasmic reticulum (ER). It consists of 406 amino acids and was originally identified as a pancreatitis-associated protein in mammals before being characterized in zebrafish. The protein contains multiple transmembrane domains and functions in several critical cellular processes, particularly at the ER membrane. In zebrafish, vmp1 is essential for survival during larval periods, with knockout models showing lethality around 9 days post-fertilization (dpf) .

Functionally, vmp1 plays crucial roles in autophagosome formation, lipoprotein secretion, and regulation of ER contact with other cellular membranes. It controls ER contact proteins VAPA and VAPB and regulates the calcium pump sarcoendoplasmic reticulum calcium transport ATPase (SERCA), which are important for maintaining proper membrane dynamics . The protein's multifaceted functions make it a critical component in cellular homeostasis across various tissues.

What are the key functions of vmp1 in zebrafish development?

Vmp1 serves several essential functions during zebrafish development:

  • Survival during larval development: Vmp1 is absolutely required for zebrafish survival through the larval period. Studies show that all vmp1-deficient zebrafish die around 9 days post-fertilization (dpf), indicating its crucial role in early development .

  • Autophagy regulation: Vmp1 is necessary for proper autophagosome formation. In vmp1-deficient zebrafish, abnormal large LC3 puncta accumulate in various tissues including the brain, spinal cord, and skeletal muscles, demonstrating defective autophagy processing .

  • Lipoprotein secretion and lipid metabolism: One of vmp1's most critical functions is facilitating the release of lipoproteins from the ER membrane. When vmp1 is absent, zebrafish display significant accumulation of neutral lipids in intestinal epithelial cells and hepatocytes, indicating defects in lipoprotein processing and secretion .

  • Swimbladder development: Vmp1-deficient zebrafish show failure of swimbladder inflation, though the precise mechanism requires further characterization .

These diverse functions highlight vmp1's multifaceted role in zebrafish development, with particularly important implications for processes involving membrane dynamics and lipid handling.

How is recombinant Danio rerio vmp1 typically produced for research?

Recombinant Danio rerio vmp1 is typically produced using bacterial expression systems, primarily in E. coli. Based on established protocols, the production process generally follows these steps:

  • Vector design and cloning: The full-length coding sequence of Danio rerio vmp1 (amino acids 1-406) is cloned into a bacterial expression vector with an N-terminal His-tag for purification purposes .

  • Expression in E. coli: The construct is transformed into E. coli expression strains, and protein production is induced under optimized conditions .

  • Purification: The recombinant protein is purified using affinity chromatography that leverages the His-tag. This typically involves immobilized metal affinity chromatography (IMAC) .

  • Processing and storage: After purification, the protein is lyophilized for long-term storage stability .

  • Quality control: The purity of the recombinant protein is assessed by SDS-PAGE, with typical preparations yielding greater than 90% purity .

For experimental use, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, addition of 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended to maintain protein integrity . It's important to note that repeated freeze-thaw cycles should be avoided to prevent protein degradation.

What phenotypes are observed in vmp1-deficient zebrafish models?

Vmp1-deficient zebrafish exhibit several distinct phenotypes that highlight the protein's crucial roles in multiple physiological processes:

  • Lethality: All vmp1-/- zebrafish die around 9 days post-fertilization (dpf), demonstrating that vmp1 is essential for survival during the larval period .

  • Abdominal opacity: The abdominal region of vmp1-/- zebrafish appears less transparent at 6 dpf, indicating the presence of abnormal deposits that are later confirmed to be accumulated lipids .

  • Swimbladder defects: Vmp1-/- zebrafish fail to inflate their swimbladder, indicating developmental abnormalities in this organ .

  • Lipid accumulation: Large neutral lipid-containing structures accumulate specifically in intestinal epithelial cells and hepatocytes, which can be visualized by oil red O staining. This represents a hallmark phenotype of vmp1 deficiency .

  • Autophagy defects: Many large LC3 puncta accumulate in several tissues, including the brain, spinal cord, and skeletal muscles. These represent abnormal autophagy-related structures typically observed in VMP1-deficient cells .

  • Biochemical changes: An increase in the levels of the lipidated form of LC3 (LC3-II) is observed, indicating blocked autophagic flux .

Importantly, the lipid accumulation phenotype appears to be specific to vmp1 deficiency and not merely a consequence of defective autophagy, as zebrafish lacking other autophagy genes (rb1cc1/fip200 or atg5) do not show similar lipid accumulation patterns .

How does vmp1 mechanistically regulate lipoprotein secretion in zebrafish?

Vmp1 regulates lipoprotein secretion in zebrafish through several mechanistic processes at the endoplasmic reticulum (ER) membrane:

  • Facilitating lipoprotein release from the ER membrane: VMP1 is essential for the release of lipoproteins from the ER membrane into the ER lumen for subsequent secretion. In VMP1-deficient cells, neutral lipids accumulate within lipid bilayers of the ER membrane, which impairs the proper assembly and secretion of lipoproteins .

  • Regulating ER membrane dynamics: VMP1 controls ER contact with other membranes, which is crucial for lipid transfer and metabolism. It regulates the calcium pump sarcoendoplasmic reticulum calcium transport ATPase (SERCA) and ER contact proteins VAPA and VAPB, which are involved in membrane contact site formation and lipid transport .

  • Creating specialized membrane domains: VMP1 forms ER subdomains enriched in phosphatidylinositol synthase, which could be important for the proper organization of lipid processing and lipoprotein assembly at the ER .

The mechanism appears to be independent of VMP1's role in autophagy, as other autophagy-deficient models (rb1cc1/fip200-/- or atg5-/- zebrafish) do not exhibit similar lipid accumulation phenotypes. This suggests that VMP1 has a specific function in lipoprotein processing that is separate from its role in autophagosome formation .

The physiological importance of this mechanism is evident from the severe phenotypes observed in vmp1-deficient zebrafish, particularly the accumulation of neutral lipids in intestinal epithelial cells and hepatocytes, which are the primary sites of lipoprotein production and secretion .

What are the differences in vmp1 function between zebrafish and mammalian models?

Comparing vmp1 function between zebrafish and mammalian models reveals both important similarities and significant differences:

Similarities:

  • Essential developmental role: VMP1 is essential for survival in both zebrafish and mice, demonstrating its evolutionary conserved importance .

  • Autophagy regulation: In both zebrafish and mammalian models, VMP1 deficiency leads to defective autophagy with accumulation of LC3-II and abnormal autophagy-related structures .

  • Lipid metabolism: VMP1 plays a crucial role in lipid processing and lipoprotein secretion in both zebrafish and mice .

Differences:

  • Timing of lethality: Vmp1-deficient zebrafish die around 9 days post-fertilization (dpf), while Vmp1-deficient mice die at a much earlier developmental stage (around 8.5 days post-coitum, which is during early embryogenesis) .

  • Severity of phenotypes: The early embryonic lethality in Vmp1-deficient mice occurs earlier than in mice deficient for other core autophagy-related genes such as Rb1cc1, Atg13, and Atg5, suggesting that VMP1 has additional critical functions in early mammalian development .

  • Intestinal phenotypes: Intestinal epithelial cell-specific Vmp1-deficient mice show milder phenotypes in lipoprotein secretion compared to intestinal epithelial cell-specific Mttp-deficient mice. For example, the level of serum triglyceride does not decrease in intestinal epithelial cell-specific Vmp1-deficient mice, suggesting subtle differences in the mechanism of lipoprotein regulation between species .

These differences highlight the evolutionary conservation of VMP1's core functions while also revealing species-specific adaptations in its regulatory roles during development and metabolism. The variation in phenotypic severity and timing suggests that mammals may have developed greater dependency on VMP1 functions during early embryonic development.

How can researchers distinguish between vmp1's role in autophagy versus its role in lipoprotein secretion?

Distinguishing between vmp1's role in autophagy versus its role in lipoprotein secretion requires careful experimental design and comparative analysis. Based on research findings, several effective approaches can be employed:

  • Comparative knockout models: The most compelling evidence comes from comparing vmp1-deficient models with models deficient in other autophagy genes. Zebrafish lacking rb1cc1/fip200 or atg5, which are core autophagy genes, display defective autophagy but do not exhibit the lipid accumulation phenotype seen in vmp1-deficient zebrafish. This indicates that vmp1's role in lipoprotein secretion is independent of its autophagy function .

  • Tissue-specific analysis: The lipid accumulation phenotype in vmp1-deficient zebrafish is specifically observed in intestinal epithelial cells and hepatocytes, which are the primary sites of lipoprotein production, but not in other tissues like the brain or skeletal muscles where autophagy defects are still observed. This tissue-specific manifestation helps distinguish between the two functions .

  • Biochemical markers: Researchers can use specific markers for autophagy (such as LC3-II accumulation and p62 levels) and lipoprotein secretion (such as ApoB levels, serum lipid profiles) to separately assess these pathways in experimental models .

  • Electron microscopy: Ultrastructural analysis can reveal distinct cellular phenotypes associated with each function - abnormal autophagosome-like structures for the autophagy function and lipid accumulation within ER membranes for the lipoprotein secretion function .

  • Domain-specific mutations: Creating specific mutations or truncations of vmp1 could potentially separate its functions in autophagy and lipoprotein secretion. By introducing these modified versions into vmp1-deficient models, researchers might rescue one function but not the other .

By combining these approaches, researchers can effectively delineate vmp1's distinct roles in autophagy and lipoprotein secretion, which appear to operate through different mechanisms despite being mediated by the same protein.

What experimental approaches are most effective for studying vmp1's role in ER membrane dynamics?

Several experimental approaches are particularly effective for studying vmp1's role in ER membrane dynamics:

  • Advanced microscopy techniques:

    • Super-resolution microscopy to visualize ER membrane subdomains

    • Live-cell imaging to track dynamic ER membrane rearrangements

    • Electron microscopy to examine ultrastructural changes in ER membrane organization in vmp1-deficient models

    • Correlative light and electron microscopy (CLEM) to connect fluorescently labeled structures with their ultrastructural features

  • Proximity labeling methods:

    • BioID or APEX2-based proximity labeling to identify proteins in close proximity to vmp1 at ER membranes

    • These approaches can reveal the protein interaction network of vmp1 at different ER subdomains

  • Membrane contact site analysis:

    • Quantification of ER contact sites with other organelles (autophagic membranes, mitochondria, lipid droplets) in the presence or absence of vmp1

    • Split-GFP approaches to visualize membrane contact sites

    • Calcium imaging to assess SERCA function at ER contact sites, which is regulated by vmp1

  • Lipid analysis techniques:

    • Lipidomics to profile changes in membrane lipid composition

    • Fluorescent lipid probes to track lipid movement between membranes

    • Biochemical fractionation to isolate and analyze ER membrane subdomains

  • Genetic and molecular tools:

    • CRISPR/Cas9-mediated genome editing to generate precise mutations in vmp1

    • Domain-specific mutants to dissect the functions of different regions of vmp1

    • Conditional knockout models to study temporal aspects of vmp1 function

  • Reconstitution systems:

    • In vitro membrane reconstitution with purified components to directly test vmp1's effects on membrane properties

    • Cell-free systems to study lipoprotein assembly and release from ER membranes

These approaches, especially when used in combination, can provide comprehensive insights into how vmp1 regulates ER membrane dynamics, contact site formation, and lipoprotein release from the ER membrane.

What are the most reliable phenotypic markers for assessing vmp1 function in zebrafish models?

Based on research findings, several reliable phenotypic markers can be used to assess vmp1 function in zebrafish models:

These markers provide a comprehensive framework for assessing vmp1 function in zebrafish models, allowing researchers to distinguish between its roles in autophagy, lipoprotein secretion, and other potential functions in different tissues and developmental stages.

How do mutations in vmp1 affect broader metabolic pathways in zebrafish?

Mutations in vmp1 have significant impacts on broader metabolic pathways in zebrafish, extending beyond its direct roles in autophagy and lipoprotein secretion:

  • Lipid metabolism disruption:

    • Defective release of lipoproteins from the ER membrane leads to accumulation of neutral lipids in intestinal epithelial cells and hepatocytes

    • Impaired transport of dietary lipids from the intestine to peripheral tissues

    • Potential shifts in energy substrate utilization due to altered lipid availability

  • Nutrient sensing and signaling:

    • Potential dysregulation of mTOR signaling, which is linked to both autophagy and nutrient sensing

    • Altered energy status could affect AMPK activity and downstream metabolic adaptations

    • Disrupted lipid homeostasis may impact insulin sensitivity and glucose metabolism

  • Cellular stress responses:

    • Accumulation of lipids within ER membranes likely triggers ER stress responses

    • Activation of unfolded protein response (UPR) pathways due to altered ER membrane properties

    • Changes in membrane composition and cellular homeostasis may increase oxidative stress

  • Membrane dynamics and composition:

    • Altered regulation of phosphatidylinositol synthase in ER subdomains

    • Changes in membrane lipid composition affecting membrane properties

    • Disrupted ER contact sites with other cellular membranes affecting interorganelle communication

  • Developmental metabolism:

    • Potential effects on the processing and utilization of yolk lipids during early development

    • Impaired transitions between different metabolic states during development

    • Differential effects on metabolism in various tissues based on their reliance on autophagy and lipid processing

These broad metabolic effects likely contribute to the lethal phenotype observed in vmp1-deficient zebrafish around 9 days post-fertilization, highlighting the crucial role of vmp1 in maintaining metabolic homeostasis during early development.

What are the comparative differences in lipid handling between vmp1-deficient zebrafish and other autophagy-deficient models?

The comparative differences in lipid handling between vmp1-deficient zebrafish and other autophagy-deficient models reveal important insights about vmp1's specific role in lipid metabolism distinct from its autophagy function:

  • Phenotypic differences:

    • vmp1-deficient zebrafish: Display pronounced accumulation of large neutral lipid-containing structures specifically in intestinal epithelial cells and hepatocytes

    • rb1cc1/fip200-deficient zebrafish: Do not show similar lipid accumulation patterns despite defective autophagy

    • atg5-deficient zebrafish: Also lack the lipid accumulation phenotype seen in vmp1-deficient fish

  • Tissue specificity:

    • vmp1 deficiency: Lipid accumulation is restricted to tissues actively involved in lipoprotein production (intestine and liver)

    • Other autophagy deficiencies: May show more generalized effects across multiple tissues

  • Subcellular localization:

    • vmp1 deficiency: Neutral lipids accumulate within lipid bilayers of the ER membrane

    • Other autophagy deficiencies: May affect lipid droplet formation or turnover through different mechanisms

  • Mechanistic basis:

    • vmp1: Directly involved in the release of lipoproteins from the ER membrane to the ER lumen

    • Other autophagy proteins: Primarily affect lipid metabolism through macroautophagy (lipophagy) or selective autophagy of lipid droplets

  • Developmental significance:

    • vmp1-deficient mice: Die around 8.5 days post-coitum, earlier than mice deficient for other autophagy genes

    • Other autophagy-deficient mice: Generally die later in development or postnatally

    • This suggests vmp1's role in lipid handling is more critical during early development

These comparative differences highlight that vmp1 has a specific and non-redundant function in lipoprotein secretion that is distinct from its role in autophagy. This function cannot be compensated by other autophagy proteins, explaining the unique lipid phenotypes observed in vmp1-deficient models.

How can researchers optimize expression systems for producing functional recombinant Danio rerio vmp1?

Optimizing expression systems for producing functional recombinant Danio rerio vmp1 requires careful consideration of several factors due to its nature as a multispanning membrane protein:

  • Expression system selection:

    • E. coli: While commonly used for its simplicity and high yield as demonstrated in the available recombinant preparations, E. coli may not provide the optimal environment for proper folding of membrane proteins like vmp1

    • Insect cells: Baculovirus-infected insect cells can provide a eukaryotic environment with better membrane protein processing capabilities

    • Yeast systems: Pichia pastoris or Saccharomyces cerevisiae can be effective for membrane protein expression

    • Mammalian cells: HEK293 or CHO cells might offer the most native-like processing but with lower yields

  • Construct design optimization:

    • Affinity tags: While His-tags are commonly used, their positioning can be critical. N-terminal tags as described in the available data may be preferable for vmp1

    • Fusion partners: Consider fusion with well-folded soluble domains to improve folding and solubility

    • Signal sequences: Addition of appropriate signal sequences can improve membrane targeting

    • Codon optimization: Adapting the codon usage to the expression host can enhance translation efficiency

  • Expression conditions:

    • Temperature: Lower temperatures (16-20°C) often improve membrane protein folding

    • Induction strategy: Gentle induction with lower inducer concentrations for longer periods

    • Media composition: Supplementation with specific lipids or membrane-stabilizing agents

    • Expression timing: Monitoring expression time courses to identify optimal harvest points

  • Purification optimization:

    • Detergent screening: Testing multiple detergents for efficient extraction while maintaining native structure

    • Lipid addition: Supplementation with lipids during purification to stabilize the protein

    • Buffer optimization: Testing various pH conditions, salt concentrations, and stabilizing agents

    • Purification methods: Two-step purification combining affinity chromatography with size exclusion or ion exchange

  • Storage considerations:

    • Cryoprotectants: Addition of glycerol (5-50%) as described in the available protocols

    • Lyophilization: Optimization of freeze-drying conditions with appropriate stabilizers

    • Aliquoting strategy: Small volume aliquots to avoid repeated freeze-thaw cycles

    • Temperature: Storage at -80°C for long-term stability

By systematically optimizing these parameters, researchers can improve the yield, purity, and most importantly, the functional integrity of recombinant Danio rerio vmp1 protein for various experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.