Recombinant Danio rerio Zinc finger protein-like 1 (zfpl1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant ZFPL1 is produced using heterologous expression systems:

  • Expression Hosts: Yeast (Saccharomyces cerevisiae) or E. coli .

  • Purification: Affinity chromatography via His tag .

  • Purity: >90% as confirmed by SDS-PAGE .

Functional and Biochemical Insights

While zebrafish ZFPL1’s exact role remains understudied, insights from homologs suggest:

  • Golgi Integrity: Human ZFPL1 stabilizes cis-Golgi structure via GM130 interactions .

  • Mitotic Phosphorylation: Phosphorylated during mitosis, implicating roles in cell division .

  • Dimerization: Forms homodimers via cysteine residues, critical for structural stability .

Research Applications

Recombinant Danio rerio ZFPL1 is primarily used in:

  1. Protein Interaction Studies:

    • Binds GM130 coiled-coil domains in yeast two-hybrid assays .

    • Cross-linking experiments confirm dimerization .

  2. Biomarker Development:

    • Human ZFPL1 is linked to neuroendocrine prostate cancer . Zebrafish homologs may aid in comparative oncology studies.

  3. Antibody Production: Serves as an antigen for generating anti-ZFPL1 antibodies .

Future Directions

  • Functional Studies: Clarify ZFPL1’s role in zebrafish Golgi dynamics.

  • Therapeutic Targets: Explore ZFPL1’s potential in cancer pathways (e.g., PI3K-Akt) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order remarks section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice delivery, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
zfpl1; zgc:63760; Zinc finger protein-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
zfpl1
Target Protein Sequence
MGLCKCPKKKVTNLFCFKHRVNVCEHCLVSNHNKCIVQSYLQWLQDSDYNPNCSLCIQPLDSQDTVRLVCYDLFHWSCLNELASHQPLNTAPDGYQCPTCQGPVFPPRNLASPVADMLREQLSSVNWARAGLGLPLIEDPEEEETTTHSGTSFSEWSTFETTSVDVSMSNPTLTSLPPHQDGEHIYNNREQSAPNNTVFNMVTTSATDTVTISTVTSPRKLYDTRDLGHSAVMQIDFDDDKYRRRPALNWFAQVLKNCTSTKKKTLALKHRIFLLLLFGVIGFFTLIIIMAKFGRASAETDPNLDPLLNPNIRIGNM
Uniprot No.

Target Background

Function
Essential for cis-Golgi integrity and efficient ER to Golgi transport.
Database Links
Protein Families
ZFPL1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of zebrafish ZFPL1?

Zebrafish ZFPL1, like its mammalian ortholog, is expected to be a conserved integral membrane protein with two predicted zinc fingers at the N-terminus, the second of which likely forms a ring domain . Based on mammalian studies, ZFPL1 functions as a structural component of the Golgi apparatus, specifically at the cis-Golgi, where it plays a crucial role in maintaining Golgi integrity .

The protein contains zinc finger domains (ZFDs) that are the most conserved parts of the protein across species, suggesting functional importance . In mammalian systems, the first domain contains the GM130-binding site, while the second domain (a predicted ring finger) may stabilize this interaction . This structural arrangement is likely conserved in the zebrafish ortholog given the high degree of conservation in Golgi trafficking mechanisms across vertebrates.

When working with recombinant Danio rerio ZFPL1, researchers should be aware that both zinc finger domains are required for proper protein function, as demonstrated in mammalian rescue experiments where mutations in either domain prevented functional rescue .

How is ZFPL1 expressed during zebrafish development?

While specific zebrafish expression data is not provided in the search results, researchers working with ZFPL1 should consider its expression pattern throughout development. Based on mammalian studies showing ZFPL1 as a widely expressed protein with tissue-specific variations, zebrafish ZFPL1 likely shows developmental stage-specific and tissue-specific expression patterns .

For experimental design, researchers should consider:

  • Performing whole-mount in situ hybridization at different developmental stages

  • Generating reporter lines with fluorescent proteins under the control of the zfpl1 promoter

  • Utilizing qPCR to quantify expression levels across developmental timepoints

  • Examining tissue-specific expression patterns through immunohistochemistry

Mammalian studies have shown that ZFPL1 expression varies significantly across tissues, with expression detected in cerebrum, cerebellum, pancreas, and endometrium, suggesting researchers should pay particular attention to neural and endocrine tissues in zebrafish .

How does zebrafish ZFPL1 compare to human ZFPL1?

While the search results don't provide direct comparison data between zebrafish and human ZFPL1, researchers should note that ZFPL1 is highly conserved across species . The zinc finger domains are particularly well-conserved, suggesting functional significance .

For researchers comparing zebrafish and human ZFPL1:

FeatureHuman ZFPL1Expected Zebrafish ZFPL1 Properties
Molecular WeightApproximately 34.1 kDa Similar due to protein conservation
Zinc Finger DomainsTwo predicted ZFDs at N-terminus Likely conserved in number and position
Subcellular Localizationcis-Golgi membranes Expected to be similar
Binding PartnersGM130 Likely conserved interaction
Role in TraffickingRequired for efficient ER-to-Golgi transport Expected to have similar function

When designing experiments with recombinant zebrafish ZFPL1, researchers should consider the degree of conservation when deciding whether findings might translate to human biology.

What are the optimal conditions for expressing recombinant Danio rerio ZFPL1?

When expressing recombinant zebrafish ZFPL1, researchers should consider the following methodological approaches based on related protein expression systems:

For bacterial expression:

  • Use E. coli strains optimized for membrane protein expression such as C41(DE3) or C43(DE3)

  • Consider fusion tags that enhance solubility (MBP, SUMO) placed at the N-terminus

  • Express at lower temperatures (16-20°C) to improve proper folding

  • Use detergents for extraction and purification due to ZFPL1 being an integral membrane protein

For mammalian expression:

  • Consider using HEK293T cells for higher yields of properly folded protein

  • Use inducible expression systems to control expression levels

  • Include the native signal sequence to ensure proper membrane targeting

  • Consider C-terminal tagging as N-terminal tags may interfere with zinc finger domains

When designing constructs, researchers should be mindful that both zinc finger domains are required for proper ZFPL1 function, and mutations in predicted zinc-coordinating residues in either domain can disrupt function while still allowing correct Golgi targeting .

What techniques are effective for studying ZFPL1 interactions with other proteins in zebrafish?

Based on mammalian ZFPL1 studies, several techniques would be effective for studying zebrafish ZFPL1 protein interactions:

  • Co-immunoprecipitation (Co-IP): This has successfully identified the interaction between ZFPL1 and GM130 in mammalian systems . For zebrafish studies, researchers should:

    • Use epitope-tagged ZFPL1 if specific antibodies against zebrafish ZFPL1 are not available

    • Include appropriate detergents in lysis buffers to solubilize membrane proteins

    • Consider crosslinking to stabilize transient interactions

    • Use stringent washing conditions to minimize false positives

  • Proximity labeling techniques:

    • BioID or TurboID fusions to ZFPL1 can identify proximal proteins in the Golgi environment

    • APEX2 fusions provide an alternative with higher spatial resolution

    • These approaches would be particularly valuable for identifying novel interaction partners unique to zebrafish

  • Fluorescence resonance energy transfer (FRET):

    • Useful for studying interactions in live zebrafish embryos

    • Can be combined with time-lapse imaging to observe dynamic interactions during development

  • Yeast two-hybrid screening:

    • While challenging for membrane proteins, modified membrane yeast two-hybrid systems could be employed

    • Consider using just the soluble N-terminal domain containing the zinc fingers for conventional Y2H

When designing interaction studies, researchers should be mindful that the first zinc finger domain of ZFPL1 contains the GM130-binding site, while the second domain may stabilize this interaction .

How can I develop effective loss-of-function models for zfpl1 in zebrafish?

Researchers interested in developing zebrafish ZFPL1 loss-of-function models should consider several complementary approaches:

  • CRISPR/Cas9 genome editing:

    • Design gRNAs targeting early exons to create frameshift mutations

    • Consider targeting the conserved zinc finger domains specifically

    • Create conditional knockout models using inducible Cas9 systems for temporal control

    • Generate domain-specific mutations rather than complete knockouts to study specific protein functions

  • Morpholino oligonucleotides:

    • Design splice-blocking morpholinos to temporarily disrupt ZFPL1 expression

    • Use translation-blocking morpholinos to prevent protein synthesis

    • Always include appropriate controls including mismatch morpholinos

    • Consider rescue experiments with co-injection of morpholino-resistant mRNA

  • Small molecule approaches:

    • Brefeldin A (BFA) treatment disrupts Golgi structure and can be used to study ZFPL1's role in Golgi reassembly

    • BFA washout experiments can assess ZFPL1's role in Golgi reassembly, as shown in mammalian studies

  • Dominant negative approaches:

    • Express mutated versions of ZFPL1 lacking functional zinc finger domains

    • Based on mammalian studies, mutations in either zinc finger domain can disrupt function

When assessing phenotypes, researchers should look for defects in:

  • Golgi structure and function

  • Cargo trafficking between ER and Golgi

  • Development of tissues where ZFPL1 is highly expressed

How can recombinant zebrafish ZFPL1 be used in genome editing applications?

Based on recent advances with zinc finger domains in recombinase programming, recombinant zebrafish ZFPL1 offers potential applications for genome editing:

  • Engineered zinc finger domains as targeting modules:

    • The zinc finger domains from ZFPL1 could be optimized and engineered to recognize specific DNA sequences

    • These modified domains could then be fused to recombinase enzymes to create site-specific recombination tools

    • Such tools would allow for precise genetic modifications in zebrafish models

  • Hybrid recombinase development:

    • Following the approach described in search result , researchers could develop hybrid systems where ZFPL1 zinc finger domains are inserted into recombinase coding sequences

    • This approach could generate recombinases that remain dormant unless the insertionally fused ZFD binds its target site

    • Such systems could provide improved editing precision for zebrafish genetic studies

  • Methodology considerations:

    • Researchers should optimize insertion sites, linker lengths, spacing, and ZFD orientation for each application

    • Testing in cell culture before moving to zebrafish embryos is recommended

    • Validation of specificity is crucial, as the hybrid approach has been shown to abolish measurable off-target activity in mammalian cells

  • Advantages over traditional approaches:

    • Increased precision with up to four-fold improvement in targeted editing efficiencies

    • Reduced off-target effects compared to conventional CRISPR-Cas9 approaches

    • Potential for scarless genetic modifications

These approaches would be particularly valuable for precise genetic engineering in zebrafish disease models.

What role does ZFPL1 play in cargo trafficking, and how can this be studied in zebrafish?

Based on mammalian studies, ZFPL1 plays an important role in cargo trafficking between the ER and Golgi apparatus, with depletion of ZFPL1 resulting in reduced efficiency of this process . To study this function in zebrafish:

  • Cargo trafficking assays:

    • Adapt the VSV-G trafficking assay used in mammalian cells for zebrafish studies

    • Employ fluorescently-tagged cargo proteins expressed in zebrafish embryos

    • Use photoactivatable fluorescent proteins fused to cargo to track transport kinetics

    • Combine with high-speed confocal microscopy for live imaging

  • Analysis of Golgi structure:

    • Examine cis-Golgi structure in ZFPL1-depleted zebrafish cells or embryos

    • Look for accumulation of Golgi matrix proteins in the intermediate compartment (IC)

    • Assess tubulation of cis-Golgi and IC membranes as observed in mammalian cells

  • Brefeldin A recovery experiments:

    • Treat zebrafish embryos or cells with BFA to disrupt the Golgi

    • Monitor Golgi reassembly during washout, comparing wild-type to ZFPL1-depleted conditions

    • This approach can reveal ZFPL1's role in Golgi assembly, which was impaired in mammalian cells after ZFPL1 depletion

  • Quantitative measurements:

    • Measure cargo delivery rates as done in mammalian systems using acquisition of EndoH resistance

    • Analyze transport kinetics using pulse-chase approaches with fluorescent cargo

    • Quantify colocalization of cargo with different organelle markers over time

These approaches would help determine whether zebrafish ZFPL1 functions similarly to its mammalian counterpart in cargo trafficking.

How does phosphorylation regulate ZFPL1 function during cell cycle, and can this be studied in zebrafish?

Mammalian ZFPL1 has been identified as a mitotic Golgi phosphoprotein , suggesting phosphorylation plays a role in regulating its function during cell cycle progression. To study this in zebrafish:

  • Identification of phosphorylation sites:

    • Perform phosphoproteomic analysis of zebrafish ZFPL1 during different cell cycle stages

    • Compare to known phosphorylation sites in mammalian ZFPL1

    • Create phosphomimetic and phospho-dead mutants for functional studies

  • Cell cycle-dependent localization:

    • Track ZFPL1 localization throughout the cell cycle in zebrafish cells

    • Compare wild-type to phosphorylation site mutants

    • Use live imaging in transparent zebrafish embryos to observe dynamic changes

  • Kinase identification:

    • Screen candidate mitotic kinases (CDK1, PLK1, Aurora kinases) for ZFPL1 phosphorylation

    • Use kinase inhibitors and genetic approaches to validate kinase-substrate relationships

    • Determine if the same kinases phosphorylate ZFPL1 in zebrafish as in mammals

  • Functional consequences:

    • Assess how phosphorylation affects ZFPL1 interactions with binding partners such as GM130

    • Determine effects on Golgi fragmentation during mitosis

    • Examine consequences for post-mitotic Golgi reassembly

A table summarizing potential phosphorylation-dependent functions could be structured as:

Cell Cycle StageExpected ZFPL1 PhosphorylationPredicted Functional Consequence
InterphaseLow phosphorylationStable cis-Golgi structure, efficient trafficking
Early mitosisIncreased phosphorylationReduced GM130 binding, contributing to Golgi fragmentation
Metaphase/AnaphaseMaximal phosphorylationComplete dissociation from Golgi matrix proteins
Telophase/CytokinesisDephosphorylationRe-association with GM130, Golgi reassembly

Can zebrafish ZFPL1 serve as a model for studying ZFPL1-related pathologies?

Based on the findings that ZFPL1 is significantly upregulated in prostate cancer and correlates with disease progression , zebrafish could serve as valuable models for ZFPL1-related pathologies:

  • Cancer modeling approaches:

    • Generate transgenic zebrafish overexpressing ZFPL1 to study consequences of upregulation

    • Create tissue-specific ZFPL1 expression models using promoters for relevant tissues

    • Combine with established zebrafish cancer models to study possible synergistic effects

    • Use xenotransplantation of human cancer cells with altered ZFPL1 expression into zebrafish embryos

  • Assessing ZFPL1 as a biomarker:

    • Determine if ZFPL1 expression changes in zebrafish cancer models

    • Validate whether such changes correlate with disease progression as observed in human prostate cancer

    • Develop fluorescent reporters under ZFPL1 control for in vivo imaging of disease progression

  • Methodology for establishing disease relevance:

    • Perform comparative expression analysis between zebrafish models and human pathological samples

    • Use CRISPR/Cas9 to introduce mutations mimicking those found in human diseases

    • Conduct high-throughput drug screens using zebrafish ZFPL1 disease models

  • Translational considerations:

    • Determine if ZFPL1 expression in zebrafish responds to hormones as observed in mammalian cells

    • Assess whether interventions targeting ZFPL1 have similar effects in zebrafish and mammalian systems

    • Validate molecular mechanisms of ZFPL1 regulation across species

The significant upregulation of ZFPL1 in human prostate cancer (over 70-fold higher in Gleason score 9 tumors compared to normal prostate) suggests that ZFPL1 could be an important factor in cancer biology, making zebrafish ZFPL1 models potentially valuable for oncology research.

How does ZFPL1 expression change under different stress conditions, and how can this be studied in zebrafish?

While the search results don't specifically address ZFPL1 regulation under stress conditions, the protein's role in Golgi structure and function suggests it may be responsive to cellular stresses. To study this in zebrafish:

  • Stress induction approaches:

    • ER stress can be induced by tunicamycin or thapsigargin treatment

    • Golgi stress can be triggered by monensin or Brefeldin A

    • Heat shock protocols can induce general cellular stress

    • Hypoxia can be controlled in zebrafish embryos through incubation conditions

  • Expression analysis methods:

    • qRT-PCR to quantify zfpl1 mRNA levels under different stress conditions

    • Western blotting to assess protein levels and post-translational modifications

    • In situ hybridization to examine tissue-specific changes in expression

    • Fluorescent reporter constructs for live imaging of expression changes

  • Functional consequences:

    • Analyze Golgi morphology under stress conditions in wild-type vs. ZFPL1-depleted zebrafish

    • Assess trafficking efficiency during recovery from stress

    • Determine if ZFPL1 overexpression provides resilience against certain stressors

  • Potential regulatory mechanisms:

    • Analyze the zfpl1 promoter for stress-responsive elements

    • Investigate involvement of stress-activated transcription factors

    • Examine post-translational modifications triggered by stress pathways

The role of ZFPL1 in maintaining cis-Golgi integrity suggests it may be particularly important during recovery from Golgi-disrupting stresses, similar to its role in Golgi reassembly after BFA treatment.

How has ZFPL1 evolved across vertebrate species, and what insights can zebrafish provide?

While specific evolutionary data isn't provided in the search results, several approaches can address this question:

  • Phylogenetic analysis approaches:

    • Compare ZFPL1 sequences across vertebrate species to construct evolutionary trees

    • Identify domains with different rates of evolutionary conservation

    • Determine if the zinc finger domains show higher conservation than other protein regions

    • Examine whether zebrafish ZFPL1 contains all functional domains found in mammalian orthologs

  • Functional conservation testing:

    • Perform cross-species rescue experiments (e.g., can zebrafish ZFPL1 rescue mammalian cell phenotypes?)

    • Test whether key protein interactions (such as with GM130) are conserved

    • Assess whether regulatory mechanisms are shared across species

  • Expression pattern comparison:

    • Compare tissue-specific expression profiles across species

    • Determine if developmental expression timing is conserved

    • Assess whether ZFPL1 responds to similar regulatory signals across species

A table summarizing expected conservation could include:

FeatureExpected Conservation Across VertebratesResearch Approach
Zinc finger domainsHigh - functional domainsSequence alignment, mutation studies
Membrane topologyHigh - structural requirementHydropathy analysis, topology mapping
GM130 bindingLikely conserved - critical functionCo-immunoprecipitation, binding assays
Tissue expression patternMay show lineage-specific differencesComparative expression analysis
Regulatory elementsPossibly divergentPromoter analysis, expression studies

Zebrafish can provide unique insights into ZFPL1 evolution due to the whole genome duplication in teleost fish, potentially revealing subfunctionalization if duplicate zfpl1 genes exist in the zebrafish genome.

Are there functional differences between ZFPL1 isoforms, and how can zebrafish models help characterize them?

The search results don't specifically address ZFPL1 isoforms, but this is an important research question that zebrafish could help address:

  • Isoform identification and characterization:

    • Use RNA-Seq data to identify alternate transcript isoforms of zebrafish zfpl1

    • Compare to known mammalian ZFPL1 isoforms

    • Characterize tissue-specific and developmental stage-specific expression of different isoforms

    • Determine if isoforms differ in subcellular localization or protein interactions

  • Functional analysis approaches:

    • Generate isoform-specific knockout/knockdown models

    • Create transgenic lines expressing each isoform for rescue experiments

    • Perform domain-swapping experiments between isoforms

    • Assess each isoform's ability to bind known partners like GM130

  • Isoform-specific interaction studies:

    • Conduct BioID or IP-MS experiments with each isoform to identify specific interaction partners

    • Compare interactomes across development or in different tissues

    • Determine if certain isoforms show altered binding to GM130 or other Golgi proteins

  • Translational relevance:

    • Investigate whether isoform expression ratios change in disease states

    • Determine if certain isoforms correlate with specific functions or pathologies

    • Assess whether findings in zebrafish translate to mammalian systems

The zebrafish model offers advantages for studying isoform function due to the ability to observe effects throughout development in a living vertebrate organism, with potential for tissue-specific and time-specific manipulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.