Recombinant Danio rerio Zinc transporter 6 (slc30a6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include these details in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
slc30a6; znt6; Zinc transporter 6; ZnT-6; Solute carrier family 30 member 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MVALDVLGITDSDAPVYRQKQEADTLVLGTIHPFRKAHRSVLGKLAQEFRLVTSDRRSWK ILLFGVLNVVCTGCLLMWCSSTNSMALTAYTYLTIFDLFSLITCLLSLWVTMKKPSQIYS FGFQRFEVLAVFSSTVLVQLGSLFILKESVERFVEQPEVHTGRLLVGTFVALFFNLLTLL SVKNKPFVFVSEAASTSWLQEHVADLSRSLCGLIPALSSFLLPRMNPFVLINLAGAFALG ITYMLIEINNYNAMDTASAVAIALMTFGTMYPMSVYSGKVLLQTTPSHVIGQLDKLLREV STLDGVLEVRNEHFWTIGFGSLAGSVHVRIRRDADEQMVLAHVWNRLSALVSALTVHVFK DEWSRASLSSGVLPSAPLSLSEYVTAAAVFPAAPSRAQGSEPTPATSTPAKPSSPPPEFS FHTPGRHVQPVVFQTAHPHRPLYGGLQGPGVRLGLGPRGPTLQAYRTLSAAPHTYTSGTY TGPPRP
Uniprot No.

Target Background

Function
Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant slc30a6?

Proper storage and handling of recombinant slc30a6 are crucial for maintaining protein integrity and experimental reproducibility. Based on manufacturer recommendations, researchers should follow these methodological guidelines:

  • Initial storage: Store the lyophilized powder at -20°C/-80°C upon receipt .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Long-term storage:

    • Create single-use aliquots to avoid repeated freeze-thaw cycles

    • Store aliquots at -20°C/-80°C

  • Working conditions:

    • Working aliquots can be stored at 4°C for up to one week

    • The protein is typically maintained in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

The importance of avoiding repeated freeze-thaw cycles cannot be overstated, as these can significantly compromise protein structure and function. For experiments requiring multiple uses, creating appropriately sized single-use aliquots during initial reconstitution is strongly recommended to maintain experimental consistency and reliable results.

How does slc30a6 function differ from other zinc transporters in the SLC30A family?

The slc30a6 protein (ZnT6) exhibits several distinctive functional characteristics that set it apart from other members of the SLC30A family:

This unique functional profile positions ZnT6 as a particularly interesting subject for research into the diverse regulatory mechanisms employed by cells to maintain precise zinc homeostasis across different subcellular compartments.

What expression systems are commonly used to produce recombinant slc30a6?

The production of high-quality recombinant slc30a6 for research applications involves specific expression systems and methodological approaches. Based on current practices, the following expression systems are most commonly employed:

  • Bacterial expression (E. coli): This is the predominant system used for recombinant slc30a6 production. The protein is typically expressed with an N-terminal His tag to facilitate purification . Key advantages include:

    • High protein yields

    • Cost-effectiveness

    • Well-established purification protocols

    • Suitability for structural and biochemical studies

  • Cell line expression systems: For functional studies requiring proper protein folding and post-translational modifications, mammalian or fish cell lines may be used:

    • Chinook salmon embryonic (CHSE-214) cells have been successfully used for expressing fish zinc transporters

    • Mammalian expression vectors (like pIRES2EGFP and pCI-neo) have been used for cloning and expressing fish zinc transporters

  • Xenopus laevis oocytes: This system has been effectively used for functional characterization of fish zinc transporters and offers advantages for electrophysiological studies .

Each expression system presents distinct advantages depending on the research objective:

  • For structural studies and binding assays: E. coli-based expression provides high yields of purified protein

  • For transport studies and functional assays: Cell-based systems or Xenopus oocytes provide a more native-like membrane environment

The choice of expression system should be guided by the specific experimental requirements and the intended applications of the recombinant protein.

What basic laboratory techniques are used to verify recombinant slc30a6 quality?

Ensuring the quality and integrity of recombinant slc30a6 is essential for reliable experimental outcomes. Researchers typically employ several complementary quality control methods:

  • Purity assessment:

    • SDS-PAGE analysis: The protein should demonstrate >90% purity with a single predominant band at the expected molecular weight (~54 kDa plus the tag size)

    • Western blotting: Using anti-His tag antibodies or specific anti-slc30a6 antibodies to confirm identity

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy: To assess secondary structure content and proper folding

    • Size-exclusion chromatography: To evaluate oligomeric state and detect aggregation

    • Thermal shift assays: To determine protein stability under various buffer conditions

  • Functional verification:

    • Binding assays: To confirm zinc-binding capability

    • Co-immunoprecipitation with ZnT5: To verify the ability to form heterodimers

    • Cell-based assays: When expressed in appropriate cell systems, the protein should localize correctly

  • Contaminant testing:

    • Endotoxin testing: Particularly important for proteins expressed in E. coli

    • Nucleic acid contamination: Measured by 260/280 nm absorbance ratio

    • Host cell protein analysis: To detect residual E. coli proteins

Systematic quality control using these methods ensures that the recombinant protein is suitable for its intended experimental applications. Documentation of these quality parameters is essential when reporting research findings to ensure reproducibility across different laboratories.

What methodologies effectively characterize the slc30a6-ZnT5 heterodimer formation?

Investigating the heterodimer formation between slc30a6 and ZnT5 requires sophisticated biochemical and biophysical approaches. The following methodological strategy provides a comprehensive framework:

  • Structural characterization:

    • Blue native PAGE: To preserve native protein complexes and detect the heterodimer

    • Chemical crosslinking followed by mass spectrometry: To identify interaction interfaces

    • Single-particle cryo-electron microscopy: To determine the heterodimer structure at near-atomic resolution

  • Biochemical interaction analysis:

    • Co-immunoprecipitation studies: Using tagged versions of both proteins to pull down the complex

    • Surface plasmon resonance (SPR): To determine binding kinetics and affinity constants

    • Isothermal titration calorimetry (ITC): To measure thermodynamic parameters of interaction

  • Molecular determinants of interaction:

    • Site-directed mutagenesis: Targeting the cytosolic carboxyl-terminal domain, particularly tyrosine residues involved in dityrosine bond formation

    • Truncation analysis: To identify minimal domains required for heterodimer formation

    • Chimeric protein analysis: Swapping domains between slc30a6 and other ZnT proteins to identify specificity determinants

  • Cellular visualization:

    • Bimolecular fluorescence complementation (BiFC): To visualize the heterodimer in living cells

    • Förster resonance energy transfer (FRET): To detect close proximity in real time

    • Proximity ligation assay (PLA): To visualize protein interactions at endogenous expression levels

  • Functional consequences of heterodimerization:

    • Zinc transport assays: Comparing activities of ZnT5 alone versus the ZnT5-slc30a6 heterodimer

    • Subcellular localization studies: To determine if heterodimerization affects protein trafficking

This systematic approach not only confirms the formation of the heterodimer but also provides mechanistic insights into how slc30a6 modulates ZnT5 function in zinc transport processes.

How can researchers effectively measure the regulatory impact of slc30a6 on zinc transport?

Measuring the modulatory effect of slc30a6 on zinc transport requires specialized techniques that can detect subtle changes in zinc movement and distribution. The following methodological approach provides a comprehensive framework:

  • Radioisotope transport studies:

    • Use of ⁶⁵Zn in cellular systems expressing ZnT5 alone or ZnT5+slc30a6

    • Measure influx/efflux rates and calculate kinetic parameters (Km, Vmax)

    • Compare transport rates under various conditions (pH gradients, ATP dependency)

  • Fluorescent zinc sensing:

    • Deploy zinc-specific fluorescent probes (FluoZin-3, Zinpyr-1) in subcellular compartments

    • Use time-lapse microscopy to track zinc movement in real-time

    • Quantify changes in fluorescence intensity as a measure of zinc concentration

  • Genetically-encoded zinc sensors:

    • Express FRET-based zinc sensors in specific compartments

    • Monitor zinc levels with high spatial and temporal resolution

    • Correlate changes with slc30a6 expression levels or mutations

  • Heterologous expression systems:

    • Xenopus oocytes provide a controlled system with minimal endogenous zinc transport

    • Use two-electrode voltage clamp to measure transport-associated currents

    • Compare currents with ZnT5 alone versus ZnT5+slc30a6

  • Cellular zinc distribution analysis:

    • Subcellular fractionation followed by ICP-MS (Inductively Coupled Plasma Mass Spectrometry)

    • X-ray fluorescence microscopy for high-resolution zinc mapping

    • Correlative light and electron microscopy with zinc detection

  • Knockout/knockdown approaches:

    • CRISPR/Cas9 knockout of slc30a6 in zebrafish or cell models

    • siRNA-mediated knockdown for acute depletion

    • Rescue experiments with wild-type or mutant slc30a6

When interpreting results, it's critical to remember that slc30a6 itself lacks direct transport activity and functions as a modulator. Therefore, experimental designs should focus on comparative analyses between systems with and without slc30a6 in the presence of ZnT5, rather than trying to measure slc30a6 transport activity directly.

What is known about the tissue-specific expression patterns of slc30a6 in zebrafish?

Understanding the tissue-specific expression pattern of slc30a6 provides critical insights into its physiological roles. While comprehensive zebrafish-specific expression data is limited in the provided search results, we can outline the methodological approach for such characterization:

  • Developmental expression analysis:

    • Whole-mount in situ hybridization (WISH) to visualize slc30a6 expression throughout embryonic development

    • Quantitative RT-PCR at different developmental stages to measure expression levels

    • Transgenic reporter lines (slc30a6 promoter driving fluorescent protein expression) to monitor expression in living embryos

  • Adult tissue expression profiling:

    • Quantitative RT-PCR across multiple tissues to determine relative expression levels

    • RNAscope in situ hybridization for high-sensitivity detection in tissue sections

    • Immunohistochemistry using slc30a6-specific antibodies to localize protein expression

  • Single-cell resolution approaches:

    • Single-cell RNA sequencing (scRNA-seq) to identify cell types expressing slc30a6

    • Spatial transcriptomics to map expression within complex tissues

    • FACS isolation of specific cell populations followed by gene expression analysis

Based on studies of zinc transporters in zebrafish, including limited data available for slc30a6, we know that:

  • Zinc transporters in zebrafish often show broad tissue distribution, with mRNA expression detected in multiple organs

  • Many zinc transporters show constitutive expression across tissues, suggesting roles in maintaining baseline zinc homeostasis

  • Expression patterns may change during development or in response to zinc availability, indicating dynamic regulatory mechanisms

A comprehensive tissue expression profile would significantly advance our understanding of slc30a6's physiological roles in zebrafish and potentially inform comparative studies with mammalian systems where SLC30A6 has been implicated in various conditions, including gastric cancer as indicated by the upregulation of SLC30A family genes (including SLC30A6) in cancer tissues .

How does slc30a6 expression respond to changes in cellular zinc status?

The responsiveness of slc30a6 to changes in zinc availability provides critical insights into its role in zinc homeostasis regulation. While specific data for slc30a6 responsiveness is limited in the provided search results, a comprehensive methodological approach to investigating this question would include:

Given the function of slc30a6 as an auxiliary subunit in a heterodimer with ZnT5, particular attention should be paid to how zinc availability affects this interaction. This could include analysis of:

  • Changes in the ZnT5:slc30a6 ratio under different zinc conditions

  • Alterations in the efficiency of heterodimer formation

  • Modifications in the modulatory effect of slc30a6 on ZnT5-mediated zinc transport

This comprehensive analysis would provide valuable insights into whether slc30a6 primarily functions in baseline zinc homeostasis or plays a specific role in adaptive responses to zinc deficiency or excess.

What functional consequences result from slc30a6 mutations or knockdown in zebrafish models?

Investigating the functional impact of slc30a6 deficiency through mutation or knockdown approaches provides critical insights into its physiological significance. A comprehensive experimental strategy would include:

  • Generation of slc30a6-deficient models:

    • CRISPR/Cas9 gene editing to create targeted mutations or complete gene knockout

    • Morpholino oligonucleotides for transient knockdown during early development

    • Conditional knockout systems to study stage-specific requirements

  • Phenotypic characterization:

    • Embryonic development assessment: Survival rates, morphological abnormalities, developmental timing

    • Behavioral analyses: Swimming patterns, response to stimuli, learning capabilities

    • Tissue-specific effects: Focus on organs known to express high levels of slc30a6

  • Zinc homeostasis evaluation:

    • Total zinc content measurement using ICP-MS across tissues

    • Visualization of free zinc using specific fluorescent probes

    • Assessment of zinc distribution between cytosol and intracellular compartments

  • Molecular consequences analysis:

    • Impact on ZnT5 expression, stability, and localization

    • Changes in other zinc transporters (potential compensatory mechanisms)

    • Effects on zinc-dependent enzymes and proteins

  • Stress response testing:

    • Challenge with zinc deficiency or excess to assess adaptive capabilities

    • Response to oxidative stress (as zinc has antioxidant functions)

    • Resistance to other stressors that might involve zinc-dependent processes

  • Rescue experiments:

    • Reintroduction of wild-type slc30a6 to confirm specificity of observed phenotypes

    • Testing of specific mutants to identify critical domains or residues

    • Structure-function analysis through chimeric constructs

Given slc30a6's role as an auxiliary subunit in heterodimers with ZnT5, particular attention should be paid to the impact of its deficiency on ZnT5 function. This unique relationship suggests that phenotypes might be more subtle than for transporters with direct zinc transport activity, emphasizing the need for sensitive and quantitative assays.

How does the amino acid sequence of slc30a6 compare across different species, and what does this reveal about functional conservation?

Evolutionary conservation analysis provides valuable insights into the structural and functional importance of specific protein domains. For slc30a6, a comprehensive comparative analysis would include:

  • Sequence alignment and conservation mapping:

    • Multiple sequence alignment of slc30a6 orthologs from diverse vertebrate species

    • Identification of highly conserved residues and domains

    • Mapping conservation onto predicted structural models

  • Phylogenetic analysis:

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Comparison with other SLC30 family members to identify unique features of slc30a6

    • Analysis of selection pressure (dN/dS ratios) across the protein sequence

  • Functional domain conservation:

    • Assessment of conservation in regions critical for:

      • Heterodimer formation with ZnT5

      • Zinc coordination sites

      • Transmembrane domains

      • Cytosolic carboxyl-terminal domain containing dityrosine bonds

  • Experimental functional conservation:

    • Cross-species complementation experiments

    • Creation of chimeric proteins to test domain functionality across species

    • Heterologous expression studies comparing transport properties

From the limited information in the search results, we know that:

  • Orthologues of zinc transporters are identified in both freshwater and seawater pufferfish (Tetraodon nigroviridis and Takifugu rubripes), suggesting functional conservation among different fish species

  • The zinc transporter function appears to be conserved, indicating that these proteins maintain similar roles across various fish species

A comprehensive conservation analysis would likely reveal:

  • Higher conservation in domains involved in core functions (zinc binding, protein-protein interactions)

  • Greater divergence in regulatory regions that might reflect species-specific adaptations

  • Conservation of key residues involved in the unique heterodimer formation with ZnT5

This evolutionary perspective provides critical context for interpreting experimental findings and can guide the design of targeted mutations to dissect protein function.

What techniques enable researchers to study the interaction between slc30a6 and other proteins in the zinc transport network?

Understanding the protein interaction network of slc30a6, particularly its heterodimer formation with ZnT5 and potential interactions with other proteins, requires sophisticated protein-protein interaction analysis techniques. A comprehensive methodological approach includes:

  • In vitro interaction studies:

    • Pull-down assays using purified recombinant proteins

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to analyze complex formation

  • Cellular interaction analysis:

    • Co-immunoprecipitation (Co-IP) to identify native protein complexes

    • Proximity-dependent biotin identification (BioID) to capture transient interactions

    • FRET/BRET approaches to monitor interactions in living cells

    • Fluorescence correlation spectroscopy (FCS) to study interaction dynamics

  • Structural characterization of complexes:

    • X-ray crystallography or cryo-EM of the ZnT5-slc30a6 heterodimer

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Cross-linking mass spectrometry to identify residues in close proximity

    • NMR spectroscopy for dynamic interaction studies

  • High-throughput interaction screening:

    • Yeast two-hybrid screens to identify novel binding partners

    • Protein microarrays to test for interactions with multiple candidates simultaneously

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Split-reporter protein complementation assays

  • Functional validation of interactions:

    • Co-expression studies to assess functional consequences of interactions

    • Mutational analysis of interaction interfaces

    • Competition assays to determine binding specificities

Particular attention should be paid to the heterodimer formation with ZnT5, as this interaction is critical for slc30a6's function. The search results specifically mention covalent dityrosine bonds within the cytosolic carboxyl-terminal domain as regulators of ZnT transporter dimerization . Therefore, methods that can specifically detect and characterize these bonds would be particularly valuable, including:

  • Redox-sensitive detection methods

  • Specific antibodies against dityrosine linkages

  • Mass spectrometry approaches optimized for dityrosine detection

This comprehensive approach would provide a detailed map of slc30a6's interactome and insights into how these interactions regulate zinc homeostasis in zebrafish.

What role might slc30a6 play in disease models or pathological conditions in zebrafish?

Investigating the potential involvement of slc30a6 in disease processes provides insights into its broader physiological significance. While specific zebrafish disease model data for slc30a6 is limited in the search results, a comprehensive research approach would include:

  • Cancer models:

    • Given that SLC30A family genes (including SLC30A6) are significantly upregulated in human gastric cancer tissues , zebrafish cancer models could be developed to:

      • Monitor slc30a6 expression changes during tumor development

      • Assess the impact of slc30a6 knockdown or overexpression on tumor progression

      • Investigate whether slc30a6 modulation affects cancer cell zinc content and metabolism

  • Neurological disorder models:

    • Due to zinc's importance in neuronal function:

      • Create zebrafish models of neurodegenerative diseases

      • Examine slc30a6 expression in neuronal tissues under pathological conditions

      • Test whether slc30a6 modulation affects disease progression or symptoms

  • Inflammatory and immune response models:

    • Given zinc's role in immune function:

      • Induce inflammatory conditions in zebrafish

      • Monitor slc30a6 expression during immune responses

      • Assess how slc30a6 deficiency impacts immune cell function and inflammatory resolution

  • Metal toxicity models:

    • Expose zebrafish to:

      • Zinc excess or deficiency

      • Other heavy metals that might interact with zinc transport pathways

      • Environmental toxicants affecting metal homeostasis

  • Developmental disorder models:

    • Create conditional knockouts to assess:

      • Critical developmental periods requiring slc30a6 function

      • Tissue-specific requirements during organogenesis

      • Long-term consequences of transient slc30a6 deficiency

A critical research direction would be investigating whether the significant upregulation of SLC30A family genes (including SLC30A6) observed in human gastric cancer is recapitulated in zebrafish cancer models. This could establish zebrafish as a valuable model organism for studying the role of zinc transporters in cancer development and potentially identify new therapeutic approaches targeting zinc homeostasis in cancer cells.

How does the ZnT5-ZnT6 heterodimer differ functionally from ZnT5 homodimers?

Comparing the functional properties of the ZnT5-slc30a6(ZnT6) heterodimer with ZnT5 homodimers provides critical insights into slc30a6's modulatory role. A comprehensive experimental approach would include:

  • Transport activity characterization:

    • Express ZnT5 homodimers or ZnT5-slc30a6 heterodimers in appropriate expression systems

    • Measure zinc transport using radioisotope transport assays or zinc-sensitive fluorescent probes

    • Determine transport kinetics (Km, Vmax) under controlled conditions

    • Assess transport efficiency across different pH values and zinc concentrations

  • Ion selectivity analysis:

    • Compare transport specificity for zinc versus other divalent metals

    • Test sensitivity to common transport inhibitors

    • Measure competitive inhibition profiles to identify binding pocket differences

  • Regulatory differences:

    • Investigate how each dimer type responds to zinc deficiency or excess

    • Examine regulation by post-translational modifications

    • Assess responses to cellular signaling pathways

    • Evaluate the impact of redox conditions on dimer function, particularly given the importance of dityrosine bonds in ZnT dimerization

  • Subcellular localization patterns:

    • Compare trafficking and localization of each dimer type

    • Assess protein stability and turnover rates

    • Identify specific cellular compartments where each dimer preferentially functions

  • Structural analysis:

    • Determine the three-dimensional structure of each dimer type

    • Identify conformational changes during the transport cycle

    • Map the heterodimer interface to understand how slc30a6 modifies ZnT5 function

Based on information in the search results, we know that:

  • In the ZnT5-ZnT6 heterodimer, ZnT6 functions as an auxiliary subunit because it lacks zinc-transport activity itself

  • ZnT6 may have a modulatory function for zinc transport rather than direct transport activity

  • Covalent dityrosine bonds within the cytosolic carboxyl-terminal domain are proposed to regulate the homo- and heterodimerization of ZnT transporters

This comparative functional analysis would provide mechanistic insights into why evolution has maintained this heterodimer formation despite the apparent lack of direct transport activity by slc30a6 itself.

What methods can be used to investigate post-translational modifications of slc30a6 and their functional significance?

Post-translational modifications (PTMs) can significantly influence protein function, localization, and interactions. For slc30a6, a comprehensive investigation of PTMs would include:

  • Identification of PTM sites:

    • Mass spectrometry-based proteomics:

      • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

      • Multiple fragmentation techniques (CID, ETD, HCD) for comprehensive coverage

      • Quantitative approaches to measure PTM stoichiometry

    • Site-specific antibodies for common PTMs

    • Bioinformatic prediction of potential modification sites

  • Functional characterization of PTMs:

    • Site-directed mutagenesis:

      • Mutation of modified residues to non-modifiable variants

      • Phosphomimetic mutations (e.g., Ser to Asp/Glu)

      • Analysis of how mutations affect protein function and localization

    • Pharmacological manipulation:

      • Inhibitors of specific kinases, phosphatases, or other modifying enzymes

      • Treatment with agents that alter cellular redox state

  • Regulation of PTMs:

    • Analysis of how zinc availability affects modification patterns

    • Investigation of signaling pathways that regulate slc30a6 PTMs

    • Examination of PTM changes during development or in disease states

  • Impact on heterodimer formation:

    • Assessment of how PTMs affect interaction with ZnT5

    • Investigation of PTM effects on dityrosine bond formation

    • Analysis of whether PTMs create binding sites for additional interacting proteins

  • Structural consequences of PTMs:

    • Structural modeling of how modifications alter protein conformation

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • NMR spectroscopy for dynamic structural alterations

Of particular interest would be the investigation of PTMs affecting the covalent dityrosine bonds within the cytosolic carboxyl-terminal domain, which are proposed to regulate the homo- and heterodimerization of ZnT transporters . This could include:

  • Identification of the specific tyrosine residues involved in these bonds

  • Analysis of the redox conditions that promote or inhibit bond formation

  • Investigation of enzymes that might catalyze or regulate dityrosine formation

This comprehensive approach would provide insights into how cells dynamically regulate slc30a6 function in response to changing physiological conditions or zinc availability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.