Recombinant Danio rerio Zinc transporter 7 (slc30a7) is produced via heterologous expression systems and is commercially available in various formats. Key attributes include:
Amino Acid Sequence:
The full-length sequence includes motifs critical for zinc transport, such as transmembrane domains and His-rich regions:
MLPLSIKDDEYKPAKFNLVVKLSGWFRSILADKTSRNLFFFLCLNLSFAFVELLYGIWSNSLGLISDSFHMFFDCTALLAGLAASVISRWRSNDSFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALEPPDVHHDRLLPVSIAGLLVNLVGIFVFQHGGHGHSHGGDDHGHSHSLFNGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCHDDHTLTPGKGS SKQILQGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILMQRTPPSLDHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILSQTHNIFTQVGVRQLYVQIEVAAM .
ZnT-7 (slc30a7) regulates intracellular zinc distribution, particularly in the Golgi apparatus, where it participates in zinc-dependent processes like protein modification and secretion. Key interactions and functions include:
Localization: Predominantly Golgi-associated, but also present in other membranes .
Regulation: Maintains cytoplasmic zinc homeostasis by sequestering zinc into Golgi vesicles .
Bioinformatics analyses (STRING database) predict interactions with other zinc transporters and regulatory proteins:
| Predicted Partner | Function | Score |
|---|---|---|
| SLC39A11 | Zinc influx transporter (ZIP family) | 0.909 |
| SLC39A9 | Zinc-influx transporter (ZIP9) | 0.819 |
| SLC30A9 | Nuclear receptor coactivator and zinc transporter | 0.744 |
| SLC30A4 | Zinc efflux transporter | 0.611 |
ZnT-7 has been implicated in metabolic regulation, particularly in pancreatic islet function. A landmark study in mice revealed:
Zinc Transporter 7 (slc30a7) is a member of the solute carrier family 30 (ZnT) subfamily of cation diffusion facilitator proteins. In zebrafish, as in other vertebrates, it functions primarily to facilitate cellular efflux of zinc, transporting this essential micronutrient from the cytoplasm into organelles or out of the cell . This transporter plays a crucial role in maintaining zinc homeostasis, which is essential for numerous biological processes including growth, development, and proper immune function .
Zebrafish slc30a7 expression demonstrates a distinct developmental pattern. Expression data shows that ZnT7 transcript levels increase steadily throughout embryonic and larval development. Specifically, from the single-cell stage (0 hours post fertilization, hpf) through 120 hpf, ZnT7 expression increases approximately 6.34-fold ± 0.41 . The expression pattern suggests that ZnT7 becomes increasingly important as development progresses, with statistically significant increases in expression observed at 48 hpf and 120 hpf compared to baseline levels at 0 hpf .
For recombinant Danio rerio slc30a7 production, Escherichia coli has been successfully employed as an expression system . When using bacterial expression systems, several considerations are critical for optimal results:
Codon optimization: Adapting the codon usage of the zebrafish gene for E. coli expression can significantly improve protein yield.
Fusion tags: N-terminal His-tags have been successfully used to facilitate purification via affinity chromatography .
Expression conditions: Optimization of induction parameters including temperature, IPTG concentration, and induction duration is necessary to maximize soluble protein expression.
Protein solubility: Membrane proteins like zinc transporters often present solubility challenges; detergent screening or fusion partners may be necessary to maintain proper folding.
Alternative expression systems such as insect cells or yeast may be considered for functional studies where post-translational modifications are essential for activity.
For optimal reconstitution of lyophilized recombinant slc30a7 protein, the following methodology is recommended:
Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the tube.
Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
Add glycerol to a final concentration of 5-50% to enhance protein stability during storage.
Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.
Store reconstituted protein at 4°C for short-term use (up to one week) or at -20°C/-80°C for long-term storage .
This protocol helps maintain protein integrity by preventing aggregation and degradation that could adversely affect downstream applications.
Recombinant Danio rerio slc30a7 provides a valuable tool for investigating zinc transport mechanisms through several methodological approaches:
Vesicular transport assays: Reconstituting purified slc30a7 into artificial liposomes loaded with zinc-sensitive fluorophores allows for quantitative measurement of transport kinetics.
Site-directed mutagenesis: Systematic modification of conserved residues can identify amino acids critical for zinc binding, transport, and regulation.
Protein-protein interaction studies: Pull-down assays using His-tagged slc30a7 can identify binding partners that regulate transporter activity or localization.
Structural biology approaches: Purified protein can be used for crystallography or cryo-EM studies to elucidate the three-dimensional structure and transport mechanism.
Electrophysiology: Expression in Xenopus oocytes or patch-clamp studies of reconstituted transporters can characterize the electrogenic properties of zinc transport.
These approaches collectively provide mechanistic insights into how slc30a7 contributes to zinc homeostasis in zebrafish cells.
The developmental regulation of slc30a7 expression reveals important insights about zinc requirements during zebrafish embryogenesis:
Temporal correlation: While zinc levels remain relatively constant throughout zebrafish development from 0-120 hpf, slc30a7 expression increases 6.34-fold during this period .
Organogenesis correlation: The significant increase in slc30a7 expression coincides with major organogenesis events, suggesting increased requirements for compartmentalization of zinc during tissue differentiation.
Comparative analysis: When considering the expression patterns of all zinc transporters, ZnT7 shows moderate upregulation compared to other family members like ZnT2 (614-fold increase) and ZnT8 (>2000-fold increase) .
Recent clinical discoveries highlight the translational significance of zebrafish slc30a7 research:
Novel human pathology: Recent identification of compound heterozygous variants in human SLC30A7 has linked this gene to a syndrome characterized by stunted growth, testicular hypoplasia, and bone marrow failure .
Mechanistic insights: Zebrafish models can elucidate the cellular and molecular mechanisms by which slc30a7 dysfunction leads to developmental abnormalities.
Phenotypic correlation: The developmental expression pattern of slc30a7 in zebrafish (increasing through development) provides context for understanding stage-specific effects of SLC30A7 variants in humans.
Therapeutic screening: Zebrafish embryos with manipulated slc30a7 expression can serve as in vivo platforms for screening compounds that might rescue zinc transport deficiencies.
The comparable developmental roles of zinc transporters between zebrafish and humans make zebrafish an excellent model for investigating the pathophysiology of SLC30A7-related human disorders.
While specific zebrafish slc30a7 mutant phenotypes aren't detailed in the provided search results, insights from human genetics and mouse models suggest:
Understanding these genotype-phenotype relationships can guide targeted investigations in zebrafish models of slc30a7 dysfunction.
Comparative analysis of zebrafish and mammalian SLC30A7 reveals important evolutionary insights:
Sequence conservation: The 387-amino acid zebrafish slc30a7 protein shows significant homology with human SLC30A7, reflecting the evolutionary conservation of zinc transport mechanisms.
Functional domains: Key structural features including transmembrane domains and histidine-rich zinc binding motifs (evident in the sequence "HGHSHGGDDHGHSHSLFNGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCH") are preserved across species .
Expression pattern similarities: Like its mammalian counterparts, zebrafish slc30a7 shows developmental regulation, suggesting conserved roles in embryogenesis.
Physiological consequences: Dysfunction of SLC30A7 in both humans and model organisms results in growth abnormalities, indicating conserved developmental functions across vertebrates .
This evolutionary conservation makes zebrafish slc30a7 a relevant model for investigating fundamental aspects of zinc transport biology applicable to human health and disease.
Rigorous experimental design for zinc transport assays using recombinant slc30a7 should include:
Negative controls:
Empty vector-transfected cells or liposomes without reconstituted protein
Transport assays performed in zinc-free buffer
Heat-inactivated protein to control for non-specific zinc binding
Positive controls:
Well-characterized zinc transporters (e.g., ZnT1) with established activity
Ionophores that facilitate zinc transport independent of protein activity
Specificity controls:
Competition assays with other divalent cations (Cd²⁺, Mn²⁺, Fe²⁺) to assess transport specificity
Site-directed mutants of critical residues in zinc-binding domains
Assays performed at different pH values to assess pH-dependency of transport
Validation approaches:
Multiple independent methods to assess zinc transport (fluorescence-based assays, radioactive ⁶⁵Zn, ICP-MS)
Correlation of in vitro transport activity with in vivo phenotypes in zebrafish models
These controls ensure that observed effects are specifically attributable to slc30a7-mediated zinc transport activity.
To ensure high-quality experimental outcomes, researchers should evaluate recombinant slc30a7 using these critical parameters:
Purity assessment:
Structural integrity:
Circular dichroism to assess secondary structure content
Thermal shift assays to evaluate protein stability
Size-exclusion chromatography to detect aggregation
Functional validation:
Zinc binding assays using fluorescent zinc probes
ATPase activity measurements if transport is energy-dependent
Reconstitution into liposomes and measurement of zinc uptake
Storage stability assessment:
Activity measurements after various storage conditions
Freeze-thaw stability tests
Assessment of lyophilization and reconstitution effects on activity
These quality control parameters ensure that experimental outcomes reflect the true biological activity of slc30a7 rather than artifacts of protein preparation.
CRISPR/Cas9 technology offers powerful approaches for investigating slc30a7 function in zebrafish:
Knockout models: Complete gene deletion to assess loss-of-function phenotypes, particularly focusing on growth, gonadal development, and hematopoiesis based on human SLC30A7 deficiency phenotypes .
Knock-in strategies:
Introduction of fluorescent tags for live imaging of protein localization during development
Creation of humanized zebrafish by replacing the endogenous gene with human SLC30A7 variants
Introduction of specific mutations corresponding to human disease variants
Tissue-specific manipulations: Using tissue-specific promoters to drive Cas9 expression for conditional knockout in specific cell lineages.
Temporal control: Employing inducible CRISPR systems to manipulate slc30a7 at specific developmental stages, correlating with the observed expression patterns across development .
Multiplexed editing: Simultaneous targeting of multiple zinc transporters to address functional redundancy and identify compensatory mechanisms.
These genomic approaches can elucidate the developmental and physiological roles of slc30a7 with unprecedented precision.
Advanced methodologies for characterizing the slc30a7 interactome include:
BioID or APEX proximity labeling: Fusion of slc30a7 with biotin ligase to identify proximal proteins in living cells, providing insights into the dynamic zinc transport machinery.
Quantitative proteomics approaches:
SILAC or TMT labeling to compare interactome changes under zinc-deficient vs. zinc-replete conditions
IP-MS using tagged recombinant slc30a7 expressed in zebrafish cells or tissues
In vivo crosslinking: Capturing transient protein-protein interactions in intact zebrafish embryos.
Split-protein complementation assays: Visualizing specific protein interactions in living zebrafish embryos through fluorescence reconstitution.
Integrative multi-omics: Combining interactome data with transcriptomics and metabolomics to construct comprehensive networks of zinc homeostasis.
These approaches will reveal how slc30a7 functions within broader cellular networks and how these interactions change during development or under zinc-deficient conditions.