Recombinant Danio rerio Zinc transporter 7 (slc30a7)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Recombinant Danio rerio Zinc transporter 7 (slc30a7) is produced via heterologous expression systems and is commercially available in various formats. Key attributes include:

ParameterDetails
UniProt IDA5PMX1
Gene Nameslc30a7; Synonyms: znt7, Zinc transporter 7
Expression SystemE. coli (full-length or partial) ; Baculovirus (partial)
TagN-terminal His-tag (10xHis) ; Tag type varies by product
Protein LengthFull-length (1-387 aa) ; Partial
Purity>90% (SDS-PAGE) ; >85% (SDS-PAGE)
StorageLyophilized: -20°C/-80°C; Liquid: -20°C/-80°C
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL); Glycerol (5-50% final conc.)

Amino Acid Sequence:
The full-length sequence includes motifs critical for zinc transport, such as transmembrane domains and His-rich regions:
MLPLSIKDDEYKPAKFNLVVKLSGWFRSILADKTSRNLFFFLCLNLSFAFVELLYGIWSNSLGLISDSFHMFFDCTALLAGLAASVISRWRSNDSFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALEPPDVHHDRLLPVSIAGLLVNLVGIFVFQHGGHGHSHGGDDHGHSHSLFNGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCHDDHTLTPGKGS SKQILQGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRESIGILMQRTPPSLDHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSRWILSQTHNIFTQVGVRQLYVQIEVAAM .

Functional Role

ZnT-7 (slc30a7) regulates intracellular zinc distribution, particularly in the Golgi apparatus, where it participates in zinc-dependent processes like protein modification and secretion. Key interactions and functions include:

Zinc Transport Mechanism

  • Localization: Predominantly Golgi-associated, but also present in other membranes .

  • Regulation: Maintains cytoplasmic zinc homeostasis by sequestering zinc into Golgi vesicles .

Functional Partners

Bioinformatics analyses (STRING database) predict interactions with other zinc transporters and regulatory proteins:

Predicted PartnerFunctionScore
SLC39A11Zinc influx transporter (ZIP family)0.909
SLC39A9Zinc-influx transporter (ZIP9)0.819
SLC30A9Nuclear receptor coactivator and zinc transporter0.744
SLC30A4Zinc efflux transporter0.611

Research Findings

ZnT-7 has been implicated in metabolic regulation, particularly in pancreatic islet function. A landmark study in mice revealed:

Impact on Glucose Metabolism

ParameterZnT7 KOZnT7/ZnT8 DKO
Zinc ContentMarkedly reduced in islets Further reduced compared to ZnT7 KO
Glucose ToleranceImpaired No significant change
Insulin SecretionReduced plasma insulin levels Abolished GSIS in isolated islets

Key Observations:

  • Compensatory Mechanism: ZnT-7 compensates for ZnT-8 (slc30a8) in insulin granule formation. Combined deletion of both transporters abolishes glucose-stimulated insulin secretion (GSIS) .

  • Islet Morphology: ZnT-7 KO mice exhibit increased α-cell/β-cell ratio and reduced pancreatic insulin content .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc30a7; znt7; si:ch211-190n7.2; si:dkey-6p9.3; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPAKFNLVVKLSGWFRSILADKTSRNLFFFLCLNLSFAFVELLYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWRSNDSFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALEPPDVHHDRLLPVSIAGLLVNLVGIFVFQHGGHGHSHGGDDHGHSHSLF NGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCHDDHTLTPGKGS SKQILQGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRES IGILMQRTPPSLDHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSR WILSQTHNIFTQVGVRQLYVQIEVAAM
Uniprot No.

Target Background

Function
This protein appears to facilitate zinc transport from the cytoplasm into the Golgi apparatus. It plays a role in regulating cellular zinc homeostasis.
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Zinc Transporter 7 (slc30a7) and what is its function in zebrafish?

Zinc Transporter 7 (slc30a7) is a member of the solute carrier family 30 (ZnT) subfamily of cation diffusion facilitator proteins. In zebrafish, as in other vertebrates, it functions primarily to facilitate cellular efflux of zinc, transporting this essential micronutrient from the cytoplasm into organelles or out of the cell . This transporter plays a crucial role in maintaining zinc homeostasis, which is essential for numerous biological processes including growth, development, and proper immune function .

How does the expression of slc30a7 change during zebrafish development?

Zebrafish slc30a7 expression demonstrates a distinct developmental pattern. Expression data shows that ZnT7 transcript levels increase steadily throughout embryonic and larval development. Specifically, from the single-cell stage (0 hours post fertilization, hpf) through 120 hpf, ZnT7 expression increases approximately 6.34-fold ± 0.41 . The expression pattern suggests that ZnT7 becomes increasingly important as development progresses, with statistically significant increases in expression observed at 48 hpf and 120 hpf compared to baseline levels at 0 hpf .

What expression systems are optimal for producing recombinant Danio rerio slc30a7?

For recombinant Danio rerio slc30a7 production, Escherichia coli has been successfully employed as an expression system . When using bacterial expression systems, several considerations are critical for optimal results:

  • Codon optimization: Adapting the codon usage of the zebrafish gene for E. coli expression can significantly improve protein yield.

  • Fusion tags: N-terminal His-tags have been successfully used to facilitate purification via affinity chromatography .

  • Expression conditions: Optimization of induction parameters including temperature, IPTG concentration, and induction duration is necessary to maximize soluble protein expression.

  • Protein solubility: Membrane proteins like zinc transporters often present solubility challenges; detergent screening or fusion partners may be necessary to maintain proper folding.

Alternative expression systems such as insect cells or yeast may be considered for functional studies where post-translational modifications are essential for activity.

What is the recommended protocol for reconstitution of lyophilized recombinant slc30a7?

For optimal reconstitution of lyophilized recombinant slc30a7 protein, the following methodology is recommended:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the tube.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% to enhance protein stability during storage.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store reconstituted protein at 4°C for short-term use (up to one week) or at -20°C/-80°C for long-term storage .

This protocol helps maintain protein integrity by preventing aggregation and degradation that could adversely affect downstream applications.

How can recombinant Danio rerio slc30a7 be used to investigate zinc transport mechanisms?

Recombinant Danio rerio slc30a7 provides a valuable tool for investigating zinc transport mechanisms through several methodological approaches:

  • Vesicular transport assays: Reconstituting purified slc30a7 into artificial liposomes loaded with zinc-sensitive fluorophores allows for quantitative measurement of transport kinetics.

  • Site-directed mutagenesis: Systematic modification of conserved residues can identify amino acids critical for zinc binding, transport, and regulation.

  • Protein-protein interaction studies: Pull-down assays using His-tagged slc30a7 can identify binding partners that regulate transporter activity or localization.

  • Structural biology approaches: Purified protein can be used for crystallography or cryo-EM studies to elucidate the three-dimensional structure and transport mechanism.

  • Electrophysiology: Expression in Xenopus oocytes or patch-clamp studies of reconstituted transporters can characterize the electrogenic properties of zinc transport.

These approaches collectively provide mechanistic insights into how slc30a7 contributes to zinc homeostasis in zebrafish cells.

How do developmental expression patterns of slc30a7 correlate with zinc requirements during zebrafish embryogenesis?

The developmental regulation of slc30a7 expression reveals important insights about zinc requirements during zebrafish embryogenesis:

  • Temporal correlation: While zinc levels remain relatively constant throughout zebrafish development from 0-120 hpf, slc30a7 expression increases 6.34-fold during this period .

  • Organogenesis correlation: The significant increase in slc30a7 expression coincides with major organogenesis events, suggesting increased requirements for compartmentalization of zinc during tissue differentiation.

  • Comparative analysis: When considering the expression patterns of all zinc transporters, ZnT7 shows moderate upregulation compared to other family members like ZnT2 (614-fold increase) and ZnT8 (>2000-fold increase) .

What insights can zebrafish slc30a7 studies provide for understanding human SLC30A7-related disorders?

Recent clinical discoveries highlight the translational significance of zebrafish slc30a7 research:

  • Novel human pathology: Recent identification of compound heterozygous variants in human SLC30A7 has linked this gene to a syndrome characterized by stunted growth, testicular hypoplasia, and bone marrow failure .

  • Mechanistic insights: Zebrafish models can elucidate the cellular and molecular mechanisms by which slc30a7 dysfunction leads to developmental abnormalities.

  • Phenotypic correlation: The developmental expression pattern of slc30a7 in zebrafish (increasing through development) provides context for understanding stage-specific effects of SLC30A7 variants in humans.

  • Therapeutic screening: Zebrafish embryos with manipulated slc30a7 expression can serve as in vivo platforms for screening compounds that might rescue zinc transport deficiencies.

The comparable developmental roles of zinc transporters between zebrafish and humans make zebrafish an excellent model for investigating the pathophysiology of SLC30A7-related human disorders.

How do mutations in slc30a7 affect zinc homeostasis and what are the phenotypic consequences?

While specific zebrafish slc30a7 mutant phenotypes aren't detailed in the provided search results, insights from human genetics and mouse models suggest:

Understanding these genotype-phenotype relationships can guide targeted investigations in zebrafish models of slc30a7 dysfunction.

How does Danio rerio slc30a7 compare structurally and functionally to mammalian SLC30A7 orthologs?

Comparative analysis of zebrafish and mammalian SLC30A7 reveals important evolutionary insights:

  • Sequence conservation: The 387-amino acid zebrafish slc30a7 protein shows significant homology with human SLC30A7, reflecting the evolutionary conservation of zinc transport mechanisms.

  • Functional domains: Key structural features including transmembrane domains and histidine-rich zinc binding motifs (evident in the sequence "HGHSHGGDDHGHSHSLFNGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCH") are preserved across species .

  • Expression pattern similarities: Like its mammalian counterparts, zebrafish slc30a7 shows developmental regulation, suggesting conserved roles in embryogenesis.

  • Physiological consequences: Dysfunction of SLC30A7 in both humans and model organisms results in growth abnormalities, indicating conserved developmental functions across vertebrates .

This evolutionary conservation makes zebrafish slc30a7 a relevant model for investigating fundamental aspects of zinc transport biology applicable to human health and disease.

What experimental controls should be included when working with recombinant slc30a7 in zinc transport assays?

Rigorous experimental design for zinc transport assays using recombinant slc30a7 should include:

  • Negative controls:

    • Empty vector-transfected cells or liposomes without reconstituted protein

    • Transport assays performed in zinc-free buffer

    • Heat-inactivated protein to control for non-specific zinc binding

  • Positive controls:

    • Well-characterized zinc transporters (e.g., ZnT1) with established activity

    • Ionophores that facilitate zinc transport independent of protein activity

  • Specificity controls:

    • Competition assays with other divalent cations (Cd²⁺, Mn²⁺, Fe²⁺) to assess transport specificity

    • Site-directed mutants of critical residues in zinc-binding domains

    • Assays performed at different pH values to assess pH-dependency of transport

  • Validation approaches:

    • Multiple independent methods to assess zinc transport (fluorescence-based assays, radioactive ⁶⁵Zn, ICP-MS)

    • Correlation of in vitro transport activity with in vivo phenotypes in zebrafish models

These controls ensure that observed effects are specifically attributable to slc30a7-mediated zinc transport activity.

What are the critical parameters for assessing purity and functionality of recombinant slc30a7 protein?

To ensure high-quality experimental outcomes, researchers should evaluate recombinant slc30a7 using these critical parameters:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity recommended)

    • Western blot using anti-His tag antibodies or specific anti-slc30a7 antibodies

    • Mass spectrometry to confirm protein identity and detect potential contaminants

  • Structural integrity:

    • Circular dichroism to assess secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Size-exclusion chromatography to detect aggregation

  • Functional validation:

    • Zinc binding assays using fluorescent zinc probes

    • ATPase activity measurements if transport is energy-dependent

    • Reconstitution into liposomes and measurement of zinc uptake

  • Storage stability assessment:

    • Activity measurements after various storage conditions

    • Freeze-thaw stability tests

    • Assessment of lyophilization and reconstitution effects on activity

These quality control parameters ensure that experimental outcomes reflect the true biological activity of slc30a7 rather than artifacts of protein preparation.

How might CRISPR/Cas9 genome editing be applied to study slc30a7 function in zebrafish development?

CRISPR/Cas9 technology offers powerful approaches for investigating slc30a7 function in zebrafish:

  • Knockout models: Complete gene deletion to assess loss-of-function phenotypes, particularly focusing on growth, gonadal development, and hematopoiesis based on human SLC30A7 deficiency phenotypes .

  • Knock-in strategies:

    • Introduction of fluorescent tags for live imaging of protein localization during development

    • Creation of humanized zebrafish by replacing the endogenous gene with human SLC30A7 variants

    • Introduction of specific mutations corresponding to human disease variants

  • Tissue-specific manipulations: Using tissue-specific promoters to drive Cas9 expression for conditional knockout in specific cell lineages.

  • Temporal control: Employing inducible CRISPR systems to manipulate slc30a7 at specific developmental stages, correlating with the observed expression patterns across development .

  • Multiplexed editing: Simultaneous targeting of multiple zinc transporters to address functional redundancy and identify compensatory mechanisms.

These genomic approaches can elucidate the developmental and physiological roles of slc30a7 with unprecedented precision.

What are the emerging techniques for studying the interactome of slc30a7 in zebrafish models?

Advanced methodologies for characterizing the slc30a7 interactome include:

  • BioID or APEX proximity labeling: Fusion of slc30a7 with biotin ligase to identify proximal proteins in living cells, providing insights into the dynamic zinc transport machinery.

  • Quantitative proteomics approaches:

    • SILAC or TMT labeling to compare interactome changes under zinc-deficient vs. zinc-replete conditions

    • IP-MS using tagged recombinant slc30a7 expressed in zebrafish cells or tissues

  • In vivo crosslinking: Capturing transient protein-protein interactions in intact zebrafish embryos.

  • Split-protein complementation assays: Visualizing specific protein interactions in living zebrafish embryos through fluorescence reconstitution.

  • Integrative multi-omics: Combining interactome data with transcriptomics and metabolomics to construct comprehensive networks of zinc homeostasis.

These approaches will reveal how slc30a7 functions within broader cellular networks and how these interactions change during development or under zinc-deficient conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.