Recombinant Dasypus novemcinctus Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Dasypus novemcinctus (Nine-banded armadillo)
Target Names
AQP2
Target Protein Sequence
SVAFSRAVLAEFLATLIFVFFGLGSALSWPQALPSVLQIALAFGLAIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPPDVRG
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel that provides the plasma membranes of renal collecting duct cells with high permeability to water, thereby enabling water to move along an osmotic gradient.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Dasypus novemcinctus Aquaporin-2 and how is it characterized?

Aquaporin-2 (AQP2) from Dasypus novemcinctus (nine-banded armadillo) is a water channel protein belonging to the aquaporin family. It is encoded by a protein-coding gene with synonyms including AQP-2, AQP-CD, and WCH-CD . Similar to aquaporins in other mammals, AQP2 likely plays a crucial role in water homeostasis, particularly in the kidneys where it mediates water reabsorption. The gene has been characterized through genomic sequencing and computational analysis, with molecular features outlined in the table below:

FeatureInformation
Gene SymbolAQP2
Entrez Gene ID101413081
Full Nameaquaporin 2
SynonymsAQP-2, AQP-CD, WCH-CD
Gene Typeprotein-coding
OrganismDasypus novemcinctus (nine-banded armadillo)
Nucleotide Sequence Length816 bp
Protein AccessionXP_004477949.1

Characterization typically involves sequence analysis, structural prediction, and functional studies comparing its properties to well-studied aquaporins from other species .

How can recombinant Dasypus novemcinctus AQP2 be produced in laboratory settings?

The production of recombinant Dasypus novemcinctus AQP2 involves several methodological steps similar to those used for other recombinant proteins from this species. Based on established protocols for armadillo proteins and standard recombinant protein techniques:

  • Obtain the AQP2 coding sequence from the armadillo genome database (accession: XM_004477892.2)

  • Design gene-specific primers for PCR amplification, incorporating appropriate restriction sites

  • Synthesize cDNA from armadillo kidney tissue (where AQP2 is likely expressed) using reverse transcription

  • Clone the amplified sequence into an expression vector such as pcDNA3.1+/C-(K)DYK, which includes a C-terminal DYKDDDDK (FLAG) tag for purification

  • Transform the recombinant plasmid into an appropriate expression system

What expression systems are most effective for functional Dasypus novemcinctus AQP2?

Different expression systems offer varying advantages for producing functional recombinant Dasypus novemcinctus AQP2:

Expression SystemAdvantagesLimitationsBest Applications
Mammalian cells (HEK293, CHO)Most native-like post-translational modifications and membrane insertionLower yields, higher costTrafficking studies, functional assays requiring authentic regulation
Insect cells (Sf9, Hi5)Good compromise between yield and proper foldingModerate cost, some glycosylation differencesStructural studies, water permeability assays
Yeast (P. pastoris)Higher yields than mammalian cells, eukaryotic processingDifferent glycosylation patternsBulk protein production for biochemical studies
Xenopus oocytesDirect functional assessment possibleNot suitable for large-scale productionWater permeability measurements, structure-function studies
E. coliHighest yield, lowest costLimited post-translational modifications, inclusion body formation commonInitial constructs testing, mutant screening

For aquaporins specifically, studies have shown that expression in Xenopus oocytes allows for direct functional assessment through swelling assays, as demonstrated with other novel aquaporins . When producing AQP2 in any system, validation of proper folding and membrane insertion is crucial before proceeding to functional studies.

How can researchers assess water channel functionality of recombinant Dasypus novemcinctus AQP2?

Water channel functionality of recombinant Dasypus novemcinctus AQP2 requires rigorous methodological approaches:

  • Xenopus oocyte expression system:

    • Inject cRNA encoding AQP2 into oocytes

    • After expression (typically 2-3 days), subject oocytes to hypotonic challenge

    • Measure swelling rates using video microscopy

    • Calculate osmotic water permeability coefficient (Pf)

    • Compare with water-injected control oocytes

    • Test inhibition with mercuric chloride, which targets cysteine residues in the water pore

  • Proteoliposome-based assays:

    • Reconstitute purified AQP2 into liposomes

    • Load vesicles with self-quenching fluorescent dye

    • Subject to osmotic gradient

    • Monitor fluorescence changes due to water flux

    • Calculate water permeability from initial rate of fluorescence change

  • Cell-based volumetric assays:

    • Express AQP2 in mammalian cells

    • Load with calcein as volume-sensitive fluorophore

    • Apply osmotic challenges

    • Monitor volume changes by fluorescence

    • Calculate water permeability relative to control cells

Studies with other aquaporins have demonstrated that mutations or truncations of regulatory domains can dramatically affect water permeability, suggesting similar structural elements may regulate Dasypus novemcinctus AQP2 function .

What are the structural characteristics that determine Dasypus novemcinctus AQP2 water selectivity?

The water selectivity of Dasypus novemcinctus AQP2 is likely determined by key structural features common to water-selective aquaporins:

  • Selectivity filter (ar/R constriction):

    • Formed by aromatic and arginine residues creating the narrowest part of the channel

    • Typically includes a conserved arginine that provides positive charge to prevent proton transport

    • Likely contains a cysteine residue that confers mercury sensitivity, as observed in other aquaporins

    • Precise dimensions (~2.8 Å) that allow water passage but exclude larger molecules

  • NPA motifs:

    • Two highly conserved asparagine-proline-alanine (NPA) sequences

    • Form hydrogen bonds with water molecules as they pass through the channel

    • Create a positive electrostatic barrier that prevents proton leakage via the Grotthuss mechanism

  • Pore-lining residues:

    • Hydrophilic amino acids that facilitate water hydrogen bonding

    • Precisely positioned to guide water molecules through the channel in single file

  • Regulatory domains:

    • Intracellular loops and termini that may regulate channel gating

    • Similar to other aquaporins where truncation of regulatory domains can activate water transport

Structure-function studies could include site-directed mutagenesis of these key residues followed by functional assessment to validate their role in water selectivity and channel regulation.

How does phosphorylation affect Dasypus novemcinctus AQP2 trafficking and function?

Phosphorylation likely plays a critical role in Dasypus novemcinctus AQP2 regulation, similar to human AQP2:

  • Predicted phosphorylation sites:

    • Conserved serine residues in the C-terminus (by comparison with human AQP2)

    • Potential targets for PKA (cAMP-dependent protein kinase)

    • Possible additional sites for other kinases (PKC, PKG, CK2)

  • Trafficking regulation:

    • Phosphorylation at specific serine residues likely triggers translocation from intracellular vesicles to plasma membrane

    • This process would be analogous to vasopressin-stimulated trafficking in human AQP2

    • Can be studied using phosphomimetic mutations (serine to aspartate/glutamate) and phospho-null mutations (serine to alanine)

  • Research approaches:

    • Phosphoproteomic analysis using mass spectrometry

    • Immunodetection with phospho-specific antibodies

    • Live cell imaging with fluorescently-tagged AQP2 constructs

    • Correlation of phosphorylation state with subcellular localization and water permeability

  • Functional consequences:

    • Changes in channel gating properties

    • Altered protein-protein interactions

    • Modified stability and turnover rates

Similar regulatory mechanisms have been observed in aquaporins from other species, where phosphorylation or other post-translational modifications affect localization and function .

What methods can detect protein-protein interactions involving Dasypus novemcinctus AQP2?

Multiple complementary approaches can identify protein-protein interactions involving Dasypus novemcinctus AQP2:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged AQP2 in cells (using the DYKDDDDK tag in available constructs)

    • Lyse cells with appropriate detergents to maintain interactions

    • Immunoprecipitate using anti-tag antibodies

    • Identify co-precipitated proteins by immunoblotting or mass spectrometry

    • Validate with reverse Co-IP using antibodies against identified partners

  • Proximity labeling approaches:

    • Generate AQP2 fusion with BioID or APEX2

    • Express in cells and activate the labeling enzyme

    • Purify biotinylated proximal proteins

    • Identify by mass spectrometry

    • Provides information on spatial proximity in native cellular environment

  • Resonance energy transfer methods:

    • Förster/Fluorescence Resonance Energy Transfer (FRET)

    • Bioluminescence Resonance Energy Transfer (BRET)

    • Requires fusion of fluorescent/luminescent proteins to AQP2 and candidate partners

    • Measures direct interactions within ~10 nm distance

  • Split-protein complementation:

    • Yeast two-hybrid for initial screening

    • Mammalian protein-fragment complementation assays (split-GFP, split-luciferase)

    • Provides functional readout of interaction in living cells

These approaches can identify trafficking partners, regulatory proteins, and other components of the water regulation machinery that interact with Dasypus novemcinctus AQP2.

How does Dasypus novemcinctus AQP2 compare to AQP2 from other species in structure and function?

Comparative analysis of Dasypus novemcinctus AQP2 with other species provides evolutionary and functional insights:

  • Sequence conservation:

    • High conservation expected in functional domains (pore region, NPA motifs)

    • Greater divergence in regulatory regions (N- and C-termini, intracellular loops)

    • Phylogenetic analysis can reveal evolutionary relationships and selective pressures

  • Structural comparisons:

    • Homology modeling using known aquaporin structures

    • Conservation of tetrameric assembly common to aquaporins

    • Species-specific differences in external loops and regulatory domains

  • Functional divergence:

    • Water permeability rates may differ between species

    • Regulation mechanisms could show adaptation to species-specific physiology

    • Susceptibility to inhibitors might vary due to subtle structural differences

  • Methodological approach:

    • Express AQP2 from multiple species under identical conditions

    • Compare water permeability using standardized assays

    • Evaluate regulatory responses to common stimuli

    • Assess trafficking dynamics in response to vasopressin or forskolin

Studies with other protein families in armadillos have shown similarities to human counterparts in key functional aspects while maintaining species-specific differences, as demonstrated with interferon gamma .

How should experiments be designed to study regulation of Dasypus novemcinctus AQP2 expression?

Robust experimental design for studying Dasypus novemcinctus AQP2 regulation should include:

  • Transcriptional regulation:

    • Isolate and characterize the AQP2 promoter region

    • Construct reporter assays with luciferase under control of the AQP2 promoter

    • Test responses to physiological stimuli (hydration status, hormones)

    • Use chromatin immunoprecipitation to identify transcription factors binding to the promoter

  • Post-transcriptional regulation:

    • Analyze mRNA stability using actinomycin D chase experiments

    • Identify microRNA binding sites in the 3' UTR

    • Assess alternative splicing patterns

    • Examine polysome association to evaluate translation efficiency

  • Post-translational regulation:

    • Study protein half-life using cycloheximide chase

    • Identify ubiquitination sites regulating degradation

    • Characterize glycosylation patterns and their functional effects

    • Map phosphorylation sites and corresponding kinases

  • Experimental controls:

    • Include time-matched untreated controls

    • Use housekeeping genes/proteins as loading controls

    • Compare with well-characterized aquaporins from other species

    • Include multiple timepoints to capture both acute and chronic regulation

  • Statistical analysis:

    • Determine appropriate sample sizes through power analysis

    • Use multiple biological and technical replicates

    • Apply appropriate statistical tests based on data distribution

    • Report effect sizes alongside significance values

This multi-level approach ensures comprehensive characterization of regulatory mechanisms affecting Dasypus novemcinctus AQP2 expression.

What are the critical considerations for site-directed mutagenesis studies of Dasypus novemcinctus AQP2?

Site-directed mutagenesis studies require careful planning and controls:

  • Target selection:

    • Conserved residues in the selectivity filter

    • Putative phosphorylation sites in regulatory domains

    • Residues in NPA motifs essential for water selectivity

    • Cysteine residues that may confer mercury sensitivity

    • Potential glycosylation sites

  • Mutation strategy:

    • Conservative vs. non-conservative substitutions

    • Phosphomimetic mutations (S/T→D/E) for regulatory sites

    • Phospho-null mutations (S/T→A)

    • Cysteine modifications (C→A or C→S)

    • Consider potential structural disruptions

  • Experimental validation:

    • Confirm mutation by sequencing

    • Verify expression levels are comparable to wild-type

    • Assess proper membrane localization before functional studies

    • Test multiple functional parameters (permeability, regulation, trafficking)

  • Controls:

    • Include wild-type protein in parallel experiments

    • Test equivalent mutations in well-characterized aquaporins

    • Use multiple independent clones for each mutant

    • Consider rescue experiments to confirm specificity

  • Interpretation:

    • Distinguish between effects on expression, trafficking, and function

    • Consider compensatory mechanisms that may mask phenotypes

    • Integrate results with structural models and evolutionary data

Studies with other aquaporins have shown that specific mutations, particularly in intracellular loops, can dramatically alter channel function, suggesting similar approaches would be informative for Dasypus novemcinctus AQP2 .

How can researchers optimize purification protocols for recombinant Dasypus novemcinctus AQP2?

Purification of recombinant Dasypus novemcinctus AQP2 requires specialized approaches for membrane proteins:

  • Solubilization optimization:

    • Screen multiple detergents (DDM, OG, LMNG, Digitonin)

    • Test detergent concentration gradients

    • Optimize temperature, time, and buffer composition

    • Consider mixed micelle approaches with lipids or cholesterol

  • Affinity purification:

    • Utilize the C-terminal DYKDDDDK tag available in expression constructs

    • Optimize binding and elution conditions

    • Consider on-column detergent exchange

    • Evaluate mild elution methods to maintain native structure

  • Secondary purification:

    • Size exclusion chromatography to isolate tetrameric assemblies

    • Ion exchange chromatography for higher purity

    • Assess homogeneity by dynamic light scattering

    • Validate oligomeric state by native PAGE

  • Functional verification:

    • Reconstitute purified protein into liposomes

    • Perform water transport assays to confirm activity

    • Test inhibition with mercuric chloride as functional verification

    • Circular dichroism to confirm secondary structure integrity

  • Storage optimization:

    • Test stability at different temperatures

    • Evaluate cryoprotectants and stabilizing additives

    • Assess activity after freeze-thaw cycles

    • Determine optimal protein concentration for stability

Successful purification protocols should be validated by demonstrating that the purified protein retains its native structure and water channel functionality.

What analytical techniques can resolve contradictory results in Dasypus novemcinctus AQP2 research?

When faced with contradictory results, researchers should employ multiple analytical approaches:

  • Independent methodology validation:

    • Apply orthogonal techniques to measure the same parameter

    • For water permeability: combine oocyte swelling, stopped-flow light scattering, and fluorescence-based assays

    • For localization: use complementary microscopy techniques (confocal, TIRF, electron microscopy)

    • For protein interactions: combine co-IP, proximity labeling, and resonance energy transfer

  • Expression system comparison:

    • Test behavior in multiple systems (mammalian cells, oocytes, yeast)

    • Compare native vs. tagged constructs

    • Evaluate effects of expression level on results

    • Consider species-specific factors in heterologous systems

  • Advanced biophysical characterization:

    • Single-molecule techniques to resolve heterogeneous populations

    • Mass spectrometry to identify post-translational modifications

    • Hydrogen-deuterium exchange to probe conformational dynamics

    • Nuclear magnetic resonance for structural analysis of specific domains

  • Computational approaches:

    • Molecular dynamics simulations to test mechanistic hypotheses

    • Statistical reanalysis of experimental data

    • Meta-analysis if multiple studies are available

    • Machine learning approaches for pattern recognition in complex datasets

  • Controlled variables identification:

    • Systematic evaluation of buffer components, pH, temperature

    • Standardization of protein preparation protocols

    • Cell passage number and culture conditions

    • Time-dependent effects that may explain discrepancies

This systematic approach can identify sources of variability and resolve contradictory results by determining which conditions produce reproducible findings.

How can researchers address low expression issues with recombinant Dasypus novemcinctus AQP2?

Low expression of recombinant Dasypus novemcinctus AQP2 can be addressed through methodical troubleshooting:

  • Sequence optimization:

    • Codon optimization for the expression host

    • Removal of cryptic splice sites or regulatory elements

    • Optimization of Kozak sequence for translation initiation

    • Elimination of secondary structures in mRNA

  • Expression vector modifications:

    • Test different promoters (strength and inducibility)

    • Evaluate signal sequences for membrane targeting

    • Try alternative fusion tags known to enhance expression

    • Consider dual selection markers for stable integration

  • Expression conditions:

    • Optimize induction parameters (timing, concentration, temperature)

    • For membrane proteins, lower temperature often improves folding

    • Test additives that stabilize membrane proteins

    • Evaluate cell density at induction time

  • Host cell engineering:

    • Select specialized cell lines for membrane protein expression

    • Consider co-expression of chaperones

    • Use protease-deficient host strains

    • Test inducible expression systems with tight regulation

  • Detection method verification:

    • Ensure antibodies recognize denatured and native forms

    • Compare multiple epitope tags positioned at different termini

    • Use sensitive methods like fluorescence detection

    • Consider in-gel detection methods specific for membrane proteins

Similar approaches have been successful for expressing other challenging armadillo proteins, such as interferon gamma, suggesting adaptability to Dasypus novemcinctus AQP2 .

What strategies can overcome protein misfolding of recombinant Dasypus novemcinctus AQP2?

Protein misfolding challenges with recombinant Dasypus novemcinctus AQP2 can be addressed through multiple strategies:

  • Expression optimization:

    • Reduce expression rate through lower temperature (16-20°C)

    • Use weaker promoters or lower inducer concentrations

    • Pulse-chase expression protocols to allow folding time

    • Co-express molecular chaperones (Hsp70, Hsp90, calnexin)

  • Buffer and additive screening:

    • Test various stabilizing compounds (glycerol, specific ions)

    • Include chemical chaperones (TMAO, betaine, sucrose)

    • Optimize pH and ionic strength for stability

    • Add specific lipids that promote proper folding

  • Construct engineering:

    • Create truncation variants to identify problematic domains

    • Introduce stabilizing mutations based on homology models

    • Design fusion constructs with well-folding partners

    • Consider synthetic orthologues with enhanced stability

  • Refolding approaches:

    • Develop protocols for refolding from inclusion bodies

    • Use detergent screening to identify optimal solubilization conditions

    • Implement step-wise dialysis for controlled refolding

    • Apply cyclodextrin-mediated detergent removal

  • Verification methods:

    • Circular dichroism to assess secondary structure

    • Intrinsic fluorescence for tertiary structure

    • Limited proteolysis to identify correctly folded domains

    • Thermal stability assays to quantify folding stability

Studies with other aquaporins have demonstrated that specific mutations or manipulations of regulatory domains can significantly impact protein folding and stability, suggesting similar approaches may benefit Dasypus novemcinctus AQP2 expression .

How can researchers validate antibody specificity for Dasypus novemcinctus AQP2?

Rigorous validation of antibody specificity for Dasypus novemcinctus AQP2 requires multiple approaches:

  • Positive and negative controls:

    • Use recombinant AQP2 as positive control

    • Include knockout or knockdown samples as negative controls

    • Test pre-immune serum to assess background

    • Compare multiple antibodies targeting different epitopes

  • Cross-reactivity assessment:

    • Test against other aquaporin family members

    • Evaluate reactivity with AQP2 from other species

    • Perform peptide competition assays

    • Check specificity in tissues with known expression patterns

  • Validation across applications:

    • Confirm specificity in multiple techniques (Western blot, immunohistochemistry, immunoprecipitation)

    • Verify detection under both denaturing and native conditions

    • Test fixation sensitivity for microscopy applications

    • Validate in both recombinant and endogenous contexts

  • Epitope mapping:

    • Identify the exact binding site using truncation or mutation analysis

    • Assess conservation of the epitope across species

    • Evaluate accessibility of the epitope in native protein

    • Consider post-translational modifications that may affect binding

  • Additional validation methods:

    • Mass spectrometry to confirm immunoprecipitated protein identity

    • Correlation of protein levels with mRNA expression

    • Immunodepletion experiments to confirm complete recognition

    • Test antibody specificity in multiple tissues or cell types

These approaches ensure that experimental results accurately reflect AQP2 biology rather than non-specific or cross-reactive antibody binding.

What approaches can distinguish between AQP2 trafficking defects and functional impairment?

Distinguishing trafficking defects from functional impairment of Dasypus novemcinctus AQP2 requires specialized experimental design:

  • Subcellular localization analysis:

    • Confocal microscopy with compartment-specific markers

    • Surface biotinylation to quantify plasma membrane expression

    • Total Internal Reflection Fluorescence (TIRF) microscopy for membrane-specific visualization

    • Subcellular fractionation followed by Western blotting

  • Function-location correlation:

    • Simultaneous measurement of localization and water permeability

    • Selectively measure function of surface-expressed protein

    • Quantitative co-localization with markers for different trafficking steps

    • Time-course analysis following stimulation

  • Manipulation approaches:

    • Force surface expression using trafficking chaperones

    • Chemical chaperones to rescue folding-defective mutants

    • Temperature-sensitive trafficking protocols

    • Selective permeabilization to access intracellular pools

  • Advanced imaging techniques:

    • Fluorescence Recovery After Photobleaching (FRAP) for mobility assessment

    • Single-particle tracking for trafficking dynamics

    • Super-resolution microscopy to resolve sub-diffraction structures

    • Correlative light and electron microscopy for ultrastructural context

  • Functional assessment methods:

    • Patch clamp of identified AQP2-expressing membrane areas

    • Stopped-flow analysis of isolated membrane vesicles

    • Single-channel water permeability measurements

    • Computational modeling to distinguish contribution factors

Similar approaches have revealed that aquaporins can be regulated at multiple levels, including both trafficking to the membrane and gating of water permeability once at the membrane surface .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.