Recombinant Dasypus novemcinctus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

The NADH-ubiquinone oxidoreductase chain 3 from Dasypus novemcinctus is a mitochondrially encoded protein that forms part of Complex I of the respiratory chain. It is officially classified as EC 1.6.5.3, reflecting its enzymatic role in the electron transport chain . The protein is known by several synonyms including MTND3, NADH3, and ND3, with MT-ND3 being the standard gene designation . This protein has been assigned the UniProt identifier O21332, facilitating its identification in protein databases and research literature .

Protein Domain Organization

The recombinant MT-ND3 protein from Dasypus novemcinctus exhibits structural features typical of mitochondrial electron transport proteins. While detailed three-dimensional structural information is not explicitly provided in the search results, analysis of the amino acid sequence suggests multiple transmembrane domains that anchor the protein within the inner mitochondrial membrane. These hydrophobic regions are critical for the protein's role in the NADH dehydrogenase complex and subsequent electron transport functions .

Expression in E. coli

The recombinant full-length Dasypus novemcinctus MT-ND3 protein can be successfully expressed in Escherichia coli expression systems. This bacterial expression platform allows for efficient production of the protein for research applications . The recombinant protein typically includes fusion tags, such as N-terminal His-tags, which facilitate purification and detection in experimental settings. The expression in E. coli systems represents a standard approach for producing mitochondrial proteins in quantities sufficient for biochemical and structural studies .

Protein Tags and Purification

Commercially available recombinant MT-ND3 from Dasypus novemcinctus is commonly produced with affinity tags to facilitate purification. Specifically, His-tagged versions of the protein have been documented, with the tag typically positioned at the N-terminus of the protein sequence . While some commercial sources indicate that tag types may be determined during the production process, His-tagging appears to be a preferred approach for this particular protein . The addition of these tags enables efficient purification through affinity chromatography, resulting in high-purity protein preparations typically exceeding 90% purity as determined by SDS-PAGE analysis .

Reconstitution Protocols

Specific protocols for the reconstitution of lyophilized recombinant MT-ND3 have been established to ensure optimal protein recovery and activity. Prior to opening, it is recommended that the vial be briefly centrifuged to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to achieve a concentration ranging from 0.1 to 1.0 mg/mL . For long-term storage of the reconstituted protein, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being a standard default concentration for many commercial preparations . This glycerol addition helps prevent protein denaturation during freeze-thaw cycles.

Buffer Composition

The recombinant MT-ND3 protein is typically provided in storage buffers optimized for stability. These buffers commonly include Tris/PBS-based formulations supplemented with stabilizing agents such as trehalose . Specifically, some commercial preparations utilize a Tris-based buffer containing 6% trehalose at pH 8.0 , while others employ Tris-based buffers with 50% glycerol . These formulations are specifically optimized to maintain the structural integrity and functional properties of the protein during storage and handling.

Analytical Applications

The recombinant MT-ND3 protein has documented applications in analytical techniques such as SDS-PAGE . This suggests its utility in protein electrophoresis studies, western blotting, and other protein characterization methods. The high purity of commercial preparations (>90%) makes this protein suitable for use as a standard or control in various analytical procedures, particularly those focused on mitochondrial proteins and their properties.

Immunological Applications

While specific immunological applications are not explicitly detailed in the search results, the recombinant MT-ND3 protein has potential utility in antibody production, immunoassay development, and immunological research. The availability of ELISA kits for this protein suggests its application in immunological detection methods . The recombinant protein could serve as an antigen for generating antibodies specific to the nine-banded armadillo MT-ND3 or for cross-reactivity studies with antibodies against homologous proteins from other species.

Function in Mitochondrial Respiration

The MT-ND3 protein plays a crucial role in the energy metabolism of Dasypus novemcinctus, functioning as an integral component of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial electron transport chain . This complex catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane. This process contributes to the establishment of the proton gradient that drives ATP synthesis through oxidative phosphorylation. The specific role of MT-ND3 within this complex likely involves membrane anchoring and participation in the conformational changes associated with electron transport and proton pumping.

Mitochondrial Genetics

As a mitochondrially encoded protein, MT-ND3 in Dasypus novemcinctus provides insights into the mitochondrial genetics of this species . The gene encoding this protein (MT-ND3) is part of the mitochondrial genome, which is maternally inherited and evolves at a different rate compared to nuclear genes. Studies on mitochondrial DNA sequence variation in populations of the nine-banded armadillo have been conducted, suggesting interest in understanding the genetic diversity and evolution of mitochondrial genes like MT-ND3 in this species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Dasypus novemcinctus (Nine-banded armadillo)
Target Names
Target Protein Sequence
MNIMITLFINMSLASLLVLIAFWLPQLNTYTEKSSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWATQANTMTPMLTTALVLILLLALGLAYEWLQKGLEWNE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MT-ND3 in Dasypus novemcinctus?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Located in the mitochondrial inner membrane, it is one of the most hydrophobic subunits forming the core of the transmembrane region . The protein participates in electron transfer from NADH to ubiquinone, making it essential for mitochondrial energy production .

In Dasypus novemcinctus (nine-banded armadillo), the MT-ND3 protein has the UniProt accession number O21332 . The protein consists of 115 amino acids with a sequence that exhibits characteristic hydrophobic properties essential for its membrane-embedded function . When expressed as a recombinant protein, it typically has a molecular weight of approximately 13 kDa, as detected through Western blotting techniques .

How does the amino acid sequence of Dasypus novemcinctus MT-ND3 compare to human MT-ND3?

The amino acid sequence of Dasypus novemcinctus MT-ND3 (UniProt O21332) contains notable hydrophobic regions that facilitate its function within the mitochondrial membrane. The sequence includes: MNIMITLFINMSLASLLVLIAFWLPQLNTYTEKSSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWATQANTMTPMLTALVLILLLALGLAYEWLQKGLEWNE .

What experimental systems are available for studying recombinant Dasypus novemcinctus MT-ND3?

Recombinant Dasypus novemcinctus MT-ND3 can be produced in various expression systems, each offering distinct advantages for different research applications:

Expression SystemAdvantagesCommon ApplicationsProduct Format
E. coli (bacterial)High yield, cost-effective, rapid expressionBasic protein interaction studies, antibody productionCSB-EP015078DIO1
YeastPost-translational modifications, proper folding of eukaryotic proteinsFunctional studies, structural analysisCSB-YP015078DIO1
Baculovirus (insect cells)Complex eukaryotic protein production, higher-order foldingEnzyme activity assays, structural studiesCSB-BP015078DIO1
Mammalian cellsNative-like post-translational modifications, ideal for complex proteinsFunctional studies, cell-based assaysCSB-MP015078DIO1

For specialized applications, biotinylated versions using Avi-tag technology are available, where E. coli biotin ligase (BirA) covalently attaches biotin to the AviTag peptide (CSB-EP015078DIO1-B) . This modification is particularly useful for protein interaction studies, pull-down assays, and immobilization applications.

What are the most effective methods for detecting MT-ND3 in experimental systems?

Detection of MT-ND3 can be accomplished using several validated techniques, with Western blotting being the most common approach. Commercial antibodies are available with demonstrated specificity for detecting the approximately 13 kDa MT-ND3 protein . For optimal results, researchers should consider:

  • Antibody selection: Both polyclonal (e.g., #45859) and monoclonal (e.g., E8O4E #82933) antibodies are available for Western blotting applications . Monoclonal antibodies typically offer superior lot-to-lot consistency and specificity.

  • Sample preparation: Given MT-ND3's hydrophobic nature and mitochondrial localization, optimization of extraction protocols is critical. Mitochondrial isolation followed by gentle detergent solubilization (e.g., digitonin or n-dodecyl β-D-maltoside) preserves complex integrity.

  • Dilution ratios: A typical starting dilution for Western blotting is 1:1000, but optimization may be required based on expression levels .

Alternative detection methods include immunoprecipitation (using antibodies such as E8O4E) and mass spectrometry for detailed characterization of post-translational modifications or interactions with other complex I components.

How can researchers effectively assess the functional activity of recombinant MT-ND3?

Functional assessment of MT-ND3 should focus on its role within Complex I. The following methodological approaches are recommended:

  • Complex I assembly analysis: Blue native polyacrylamide gel electrophoresis (BN-PAGE) can determine whether MT-ND3 properly incorporates into the 950-kDa whole Complex I structure . Absence of MT-ND3 prevents complete assembly, providing a clear endpoint for functional assessment.

  • Enzyme activity assays: NADH:ubiquinone oxidoreductase activity can be measured spectrophotometrically by monitoring NADH oxidation at 340 nm, or using artificial electron acceptors like ferricyanide.

  • ATP production measurement: As demonstrated in clinical research, MT-ND3 functionality affects ATP production capacity with substrates utilized by Complex I . This can be quantified using luminescence-based ATP detection assays.

  • RNA interference approaches: Following the methodology used in Chlamydomonas reinhardtii studies, targeted suppression of MT-ND3 expression can demonstrate functional consequences, including preventing assembly of the full 950-kDa complex and suppressing enzyme activity .

What are the optimal storage and handling conditions for recombinant MT-ND3?

For maintaining optimal activity and stability of recombinant Dasypus novemcinctus MT-ND3:

  • Storage format: The protein is typically supplied as a lyophilized powder, which should be briefly centrifuged before opening to ensure the contents settle at the bottom of the vial .

  • Reconstitution: Use a Tris-based buffer system with 50% glycerol that has been optimized specifically for this protein's stability .

  • Temperature considerations: Store stock solutions at -20°C for regular use, or at -80°C for extended storage periods . Repeated freeze-thaw cycles should be avoided to prevent protein denaturation and loss of activity.

  • Working aliquots: Prepare small working aliquots and store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Antibody storage: For antibodies targeting MT-ND3, do not aliquot to maintain optimal stability and performance .

How are mutations in MT-ND3 associated with human diseases, and can the armadillo MT-ND3 serve as a model?

Mutations in human MT-ND3 are associated with several significant clinical conditions, primarily due to mitochondrial Complex I deficiency (MT-C1D) . These include:

  • Leigh syndrome: A severe neurological disorder characterized by progressive loss of mental and movement abilities.

  • Leber hereditary optic neuropathy (LHON): Causing sudden vision loss, particularly in young adult males.

  • Mitochondrial encephalopathy: Broader neurological impairments affecting brain function .

  • Sensorimotor axonal polyneuropathy: A novel mutation (m.10372A>G) in MT-ND3 has been reported causing adult-onset sensorimotor axonal polyneuropathy .

The Dasypus novemcinctus MT-ND3 can serve as a comparative model for studying these conditions through:

  • Structure-function analysis: Comparing conserved domains where human pathogenic mutations occur.

  • Heterologous expression: Introducing human disease-associated mutations into recombinant armadillo MT-ND3 to assess functional consequences.

  • Evolutionary conservation studies: Examining which functional regions are preserved across species, indicating critical domains where mutations would likely be pathogenic.

What methodological approaches are used to analyze MT-ND3 mutations in clinical research?

Clinical investigation of MT-ND3 mutations employs several sophisticated methodologies:

  • Genetic analysis: Whole-genome sequencing (WGS) of DNA from affected tissues and Sanger sequencing of mitochondrial DNA to identify mutations .

  • Heteroplasmy quantification: Last-cycle hot PCR can be employed to determine heteroplasmic levels (percentage of mutated mtDNA) in different tissues . This is crucial as the mutation load often correlates with clinical manifestations.

  • Morphological assessment: Muscle biopsies may show characteristic findings such as ragged red fibers and paracrystalline inclusions when analyzed by microscopy .

  • Biochemical investigations:

    • Complex I respiratory chain activity measurement

    • Adenosine triphosphate (ATP) production assays with various substrates

    • Oxygen consumption rate measurement in tissue samples and cultured cells

  • Cultured cell studies: Comparison of biochemical parameters between patient-derived primary cells and control samples can establish pathogenicity of novel mutations .

How does the relocation of ND3 from mitochondrial to nuclear genome in some species impact research approaches?

  • Comparative protein characteristics: Nuclear-encoded ND3 proteins typically show reduced hydrophobicity compared to their mitochondrial-encoded counterparts, facilitating their import into mitochondria . This modified hydrophobicity profile represents an adaptation to the constraints of protein import machinery.

  • Genetic manipulation advantages: Nuclear-encoded genes are more amenable to genetic manipulation techniques like RNA interference, providing valuable experimental models . This allows for precise control over expression levels not easily achieved with mitochondrially-encoded genes.

  • Import mechanisms: Studying species with nuclear-encoded ND3 provides insights into mitochondrial import mechanisms for highly hydrophobic proteins.

  • Evolutionary analysis: Investigating the selective pressures and advantages of gene relocation between organellar and nuclear genomes enhances understanding of mitochondrial evolution.

What techniques are available for investigating the assembly of MT-ND3 into Complex I?

Understanding how MT-ND3 integrates into the larger Complex I structure requires specialized techniques:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact membrane protein complexes while preserving their native structure. Research has demonstrated that absence of ND3 prevents assembly of the 950-kDa whole complex I .

  • Immunoprecipitation with antibodies against MT-ND3 or other Complex I components can pull down interaction partners to map assembly intermediates .

  • Cryo-electron microscopy (cryo-EM): Recent advances have enabled high-resolution structural determination of Complex I, including the positioning of MT-ND3 within the membrane arm.

  • Pulse-chase experiments: Radioactive labeling of newly synthesized proteins coupled with immunoprecipitation can track the kinetics of MT-ND3 incorporation into assembly intermediates.

  • Crosslinking mass spectrometry: This approach can identify protein-protein interactions between MT-ND3 and neighboring subunits within Complex I.

How can researchers effectively express and purify highly hydrophobic MT-ND3 for structural studies?

MT-ND3's high hydrophobicity poses significant challenges for expression and purification for structural studies. Based on current methodologies:

  • Expression system selection: While E. coli systems can produce high yields, eukaryotic systems (particularly insect or mammalian cells) often provide better folding of hydrophobic membrane proteins .

  • Fusion partners: Addition of solubility-enhancing tags (MBP, SUMO, or thioredoxin) can improve expression and solubility.

  • Detergent screening: Systematic testing of detergents (DDM, digitonin, LMNG) is crucial for extracting MT-ND3 while maintaining native structure.

  • Nanodiscs or amphipols: These membrane-mimetic systems can stabilize purified MT-ND3 in a native-like environment for structural studies.

  • Co-expression strategies: Expressing MT-ND3 alongside interacting partners from Complex I may improve folding and stability.

  • Reconstitution approaches: Following the method used for biotinylated constructs, where specific tags like Avi-tag facilitate downstream applications, can enhance purification efficiency .

What are emerging approaches for studying MT-ND3 interactions with other Complex I components?

Cutting-edge approaches for investigating MT-ND3's interactions within Complex I include:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map dynamic interactions between MT-ND3 and other subunits by measuring the accessibility of different protein regions to solvent.

  • CRISPR-based proximity labeling: By fusing biotin ligases to MT-ND3, researchers can identify proximal proteins through biotinylation and subsequent purification.

  • Single-molecule FRET (Förster Resonance Energy Transfer): This approach can measure distances between labeled components in real-time, providing insights into conformational changes during Complex I assembly and function.

  • AlphaFold and other AI-based structural prediction: These computational approaches can predict interaction interfaces between MT-ND3 and other Complex I components when experimental structures are unavailable.

  • Comparative species analysis: Examining MT-ND3 from different species (including Dasypus novemcinctus) can reveal evolutionarily conserved interaction sites critical for Complex I assembly and function.

How can recombinant MT-ND3 be utilized in developing therapies for mitochondrial disorders?

Recombinant MT-ND3 has potential therapeutic applications for mitochondrial disorders:

  • Drug screening platforms: Reconstituted systems containing recombinant MT-ND3 can serve as platforms for screening compounds that stabilize Complex I or bypass defects.

  • Mutation-specific therapies: Understanding how specific mutations affect MT-ND3 structure and function can guide development of personalized therapeutic approaches:

    • For the novel m.10372A>G mutation causing sensorimotor axonal polyneuropathy, therapeutic development could target the specific biochemical defect .

    • Leigh syndrome-associated mutations might require different approaches based on their impact on enzyme activity versus assembly.

  • Gene therapy vectors: Knowledge gained from studying nuclear-encoded ND3 in species like Chlamydomonas reinhardtii could inform development of gene therapy approaches , potentially allowing nuclear expression of modified, import-compatible MT-ND3 to bypass mitochondrial DNA mutations.

  • Biomarker development: Recombinant MT-ND3 and antibodies against it can facilitate development of diagnostic assays for mitochondrial disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.