Recombinant Daubentonia madagascariensis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag is determined during production. Please inform us of your tag requirements for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Daubentonia madagascariensis (Aye-aye) (Sciurus madagascariensis)
Target Names
Target Protein Sequence
MAYPAQMGFQDATSPIMEELLYFHDHTLMIVFMISSLVLYTISLMLTTSLTHTNTMNAQE VETVWTILPAIICILIALPSLRILYMMDEINNPSLTIKTMGHQWYWTYEYTDYENMTFDS YMTSTNDLTPGELRLLEVDNRMVLPTELPIRVLVSSEDVLHSWTVPSLGLKTDAIPGRLN QTTLMASRPGLYYGQCSEICGANHSFMPIVLELIPLKYFEKWLLTML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site, a binuclear center (BNC) comprising heme A3 and copper B (CuB) in subunit 1. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and what is its role in cellular metabolism?

Cytochrome c oxidase subunit 2 (MT-CO2) is one of the core subunits of the mitochondrial respiratory complex IV (cytochrome c oxidase). It contains a dual core CuA active site that plays a critical role in the electron transport chain. MT-CO2 facilitates the transfer of electrons from reduced cytochrome c to molecular oxygen, ultimately forming water in the final step of the mitochondrial respiratory chain. This process is essential for cellular energy production through oxidative phosphorylation . In the aye-aye (Daubentonia madagascariensis), this protein is encoded by the mitochondrial genome and consists of 227 amino acid residues with specific structural features that contribute to its function in electron transport .

How does recombinant MT-CO2 differ from native MT-CO2 in functional assays?

When comparing recombinant MT-CO2 with native MT-CO2, several functional differences may be observed in enzymatic assays. Recombinant proteins often contain affinity tags (such as 6-His) that may influence their tertiary structure and activity. Studies on similar cytochrome c oxidase subunits have shown that recombinant versions can catalyze the oxidation of substrate cytochrome c, although sometimes with altered kinetics compared to native proteins .

For functional characterization, techniques such as UV-spectrophotometry and infrared spectrometry can be employed to measure enzymatic activity. The recombinant protein's ability to bind substrates and cofactors, such as copper ions essential for the CuA center, may also vary compared to the native form. Researchers should evaluate whether the recombinant protein forms proper associations with other subunits of the cytochrome c oxidase complex, as these interactions are crucial for full enzymatic function .

What are the optimal expression systems for producing functional recombinant Daubentonia madagascariensis MT-CO2?

The choice of expression system for recombinant Daubentonia madagascariensis MT-CO2 requires careful consideration of several factors, particularly given its mitochondrial origin and membrane-associated nature. While bacterial systems like E. coli (such as Transetta DE3) have been successfully used for expressing similar cytochrome c oxidase subunits , eukaryotic expression systems may provide advantages for mitochondrial proteins.

For optimal expression:

Expression SystemAdvantagesLimitationsRecommended Modifications
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modifications, potential improper foldingUse specialized strains (Rosetta, Origami), lower induction temperature (16-20°C), co-expression with chaperones
Yeast (P. pastoris, S. cerevisiae)Post-translational modifications, membrane protein handlingLonger cultivation time, complex media requirementsOptimize codon usage, use inducible promoters like AOX1
Mammalian cellsClosest to native processing and foldingHigher cost, lower yield, longer production timeStable cell line development, optimized vector design
Insect cellsHigh expression levels, post-translational modificationsComplex cultivation requirementsBaculovirus expression vector system optimization

For membrane proteins like MT-CO2, solubilization strategies might include fusion tags (SUMO, thioredoxin) or the incorporation of suitable detergents during purification. Expression vectors should include appropriate signal sequences to direct proper membrane insertion during production .

What methodologies are most effective for assessing the structural integrity and functional activity of recombinant MT-CO2?

Multiple complementary methodologies should be employed to comprehensively assess recombinant MT-CO2:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography to verify oligomeric state

    • Western blotting with conformation-specific antibodies

  • Functional Activity Analysis:

    • Enzyme kinetics using cytochrome c oxidation assays with varied substrate concentrations

    • Spectrophotometric analysis to measure binding of heme a3 and copper incorporation

    • CO flash-photolysis and recombination signals monitoring, which can detect proper heme a3 incorporation

    • Polarographic assays to measure oxygen consumption rates

  • Interaction Studies:

    • Co-immunoprecipitation with other cytochrome c oxidase subunits

    • Surface plasmon resonance (SPR) to quantify binding affinities

    • Reconstitution experiments with other purified subunits to assess complex assembly

For membrane proteins like MT-CO2, incorporation into nanodiscs or liposomes may help maintain native-like environments for functional studies. Comparing activity parameters with those of the native enzyme complex is essential for validating the recombinant protein's functionality .

How can researchers effectively study the interactions between recombinant MT-CO2 and other subunits of the cytochrome c oxidase complex?

Studying the interactions between recombinant MT-CO2 and other cytochrome c oxidase subunits requires specialized approaches due to the complex nature of multisubunit membrane proteins:

  • Reconstitution Experiments:

    • Stepwise reconstitution of the complex using purified subunits

    • Monitoring assembly intermediates through blue native PAGE

    • Measuring enzymatic activity at each assembly stage to identify critical interactions

  • Cross-linking Studies:

    • Chemical cross-linking followed by mass spectrometry (XL-MS) to map interaction interfaces

    • Photo-activatable cross-linkers for capturing transient interactions

    • Analysis of cross-linked products by SDS-PAGE and immunoblotting with subunit-specific antibodies

  • Biophysical Interaction Analysis:

    • Microscale thermophoresis (MST) for quantifying interactions in solution

    • Fluorescence resonance energy transfer (FRET) for monitoring proximity in reconstituted systems

    • Analytical ultracentrifugation to characterize complex formation

  • Computational Approaches:

    • Molecular docking simulations based on available structural data

    • Molecular dynamics simulations to predict stability of subunit interactions

    • Homology modeling using related cytochrome c oxidase structures as templates

These studies should particularly focus on the crucial interaction between MT-CO2 and MT-CO1, as evidence from mutation studies indicates this association is necessary for stabilizing the binding of heme a3 to MT-CO1 .

What are the optimal conditions for purification and storage of recombinant Daubentonia madagascariensis MT-CO2?

Purification and storage of recombinant MT-CO2 requires careful optimization to maintain structural integrity and functional activity:

Purification Protocol:

  • Affinity chromatography using Ni²⁺-NTA agarose for His-tagged proteins, with sequential washing steps using increasing imidazole concentrations (20-50 mM) to reduce non-specific binding

  • Ion exchange chromatography as a secondary purification step to remove remaining contaminants

  • Size exclusion chromatography for final polishing and buffer exchange

  • Incorporation of appropriate detergents (e.g., n-dodecyl-β-D-maltoside at 0.1-0.5%) throughout purification to maintain membrane protein solubility

Optimal Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol at -20°C for routine use

  • For extended storage, maintain at -80°C in single-use aliquots

  • Avoid repeated freeze-thaw cycles which can significantly reduce activity

  • Working aliquots can be stored at 4°C for up to one week

Stability Considerations:

  • Monitor protein stability using activity assays before and after storage

  • Consider the addition of stabilizing agents such as glycerol, sucrose, or specific metal cofactors

  • For long-term preservation, lyophilization may be considered with appropriate cryoprotectants

The purity of the final preparation should be assessed by SDS-PAGE, and activity should be verified before storage using appropriate enzymatic assays .

What expression vector design elements are critical for successful production of recombinant MT-CO2?

The design of expression vectors for recombinant MT-CO2 production should incorporate several key elements to optimize expression and functionality:

  • Promoter Selection:

    • For bacterial systems: T7 promoter with lac operator control for IPTG-inducible expression

    • For yeast systems: AOX1 (methanol-inducible) or GAP (constitutive) promoters

    • For mammalian systems: CMV or EF1α promoters for strong expression

  • Codon Optimization:

    • Adapt the MT-CO2 coding sequence to the codon usage bias of the host organism

    • Eliminate rare codons that might cause translational pausing or premature termination

    • Optimize GC content for stable mRNA secondary structure

  • Fusion Tags and Linkers:

    • N-terminal or C-terminal histidine tags (6x or 10x) for purification

    • Thioredoxin or SUMO tags to improve solubility

    • TEV or PreScission protease cleavage sites for tag removal

    • Flexible glycine-serine linkers between protein and tags to minimize interference

  • Signal Sequences:

    • Consider including appropriate signal peptides for membrane targeting

    • For bacterial systems, pelB or ompA leader sequences may improve membrane insertion

    • For eukaryotic systems, native mitochondrial targeting sequences may enhance proper localization

  • Selection Markers:

    • Antibiotic resistance genes appropriate for the host system

    • Auxotrophic markers for yeast systems

    • Fluorescent protein reporters to monitor expression levels

Expression vector design should also include appropriate transcription terminators and ribosome binding sites optimized for the host system .

How can researchers troubleshoot low expression or activity issues with recombinant MT-CO2?

When encountering challenges with recombinant MT-CO2 expression or activity, a systematic troubleshooting approach should be employed:

Expression Issues:

ProblemPotential CausesTroubleshooting Strategies
Low expression levelCodon bias, protein toxicity, improper inductionTry different host strains, optimize codon usage, reduce induction temperature, use cell-free expression systems
Inclusion body formationRapid expression rate, improper foldingLower induction temperature (16-20°C), reduce inducer concentration, co-express with molecular chaperones
Protein degradationProtease activity, instabilityAdd protease inhibitors, use protease-deficient strains, optimize buffer conditions
Poor membrane integrationInadequate membrane targetingInclude appropriate signal sequences, use specialized membrane protein expression systems

Activity Issues:

ProblemPotential CausesTroubleshooting Strategies
Low enzymatic activityImproper folding, missing cofactors, unsuitable assay conditionsSupplement with copper ions, optimize buffer conditions, try refolding protocols
Poor complex assemblySubunit stoichiometry issues, missing partner proteinsCo-express with other subunits, reconstitute with purified components
Inhibition by purification tagsTag interference with active site or binding regionsUse different tag positions, include longer linkers, remove tags enzymatically
Detergent interferenceInappropriate detergent selectionScreen different detergents, use nanodiscs or liposomes for functional studies

Analytical Approaches:

  • Compare expression and activity under different conditions using well-designed controls

  • Employ structural analysis (e.g., CD spectroscopy) to verify protein folding

  • Conduct comparative spectroscopic analysis with native enzyme to identify differences

  • Use CO flash-photolysis or other specialized techniques to assess heme incorporation

A particularly useful approach is to introduce specific mutations that are known to affect activity in related proteins, which can help identify whether the issue is with protein expression, folding, or specific aspects of catalytic function .

What are the most informative spectroscopic methods for characterizing recombinant MT-CO2 and interpreting the results?

Several spectroscopic techniques provide valuable information for characterizing recombinant MT-CO2:

  • UV-Visible Spectroscopy:

    • Characteristic absorption peaks at 440-450 nm and 600-605 nm indicate proper heme incorporation

    • The ratio of absorbance at 280 nm (protein) to 440 nm (heme) provides information about heme content

    • Difference spectra (reduced minus oxidized) can reveal proper redox center formation

  • CO-Binding Spectroscopy:

    • CO binding shifts the Soret band from ~440 nm to ~430 nm

    • CO flash-photolysis and recombination kinetics can detect proper heme a3 incorporation and accessibility

    • Biphasic recombination signals can be analyzed to distinguish between contaminating hemoglobin signals (fast component, K=500-600 s⁻¹) and authentic heme a3 signals (slow component, K=60-65 s⁻¹)

  • Electron Paramagnetic Resonance (EPR):

    • Detects the copper centers in MT-CO2 (CuA exhibits characteristic signals)

    • Provides information about the oxidation state and environment of metal centers

    • Can assess proper copper incorporation in the recombinant protein

  • Circular Dichroism (CD):

    • Far-UV CD (190-250 nm) provides information about secondary structure

    • Near-UV CD (250-350 nm) reflects tertiary structure and aromatic amino acid environments

    • Thermal denaturation monitored by CD can assess stability differences

  • Infrared Spectroscopy:

    • Can detect specific structural features and conformational changes

    • Useful for monitoring enzyme-substrate interactions

    • Can be used to study the influence of allosteric effectors

Data Interpretation Guidelines:

  • Compare spectroscopic profiles with native enzyme or well-characterized recombinant versions

  • Correlate spectroscopic data with functional activity measurements

  • Use multiple techniques to build a comprehensive picture of protein structure and function

  • Consider the effects of experimental conditions (pH, temperature, ionic strength) on spectroscopic properties

How can researchers accurately assess the kinetic parameters of recombinant MT-CO2 and compare them with the native enzyme?

Accurate assessment of kinetic parameters for recombinant MT-CO2 requires rigorous experimental design and data analysis:

Experimental Design Considerations:

  • Establish standardized assay conditions that mimic physiological environments

  • Use multiple substrate concentrations to determine Michaelis-Menten parameters

  • Ensure measurement in the linear range of both substrate conversion and enzyme concentration

  • Include appropriate controls (heat-inactivated enzyme, no-enzyme controls)

Kinetic Parameters to Measure:

  • Km for cytochrome c (substrate affinity)

  • kcat (catalytic rate constant)

  • kcat/Km (catalytic efficiency)

  • Inhibition constants for known inhibitors

  • pH-dependent activity profile

  • Temperature-dependent activity profile

Methodology for Comparative Analysis:

  • Polarographic methods to measure oxygen consumption rates

  • Spectrophotometric assays monitoring cytochrome c oxidation at 550 nm

  • Stopped-flow techniques for rapid kinetics measurements

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

Data Analysis Approach:

  • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, allosteric models if applicable)

  • Use linear transformations (Lineweaver-Burk, Eadie-Hofstee) for visual assessment but rely on non-linear regression for parameter determination

  • Calculate and compare confidence intervals for all parameters

  • Apply statistical tests to determine significance of differences between recombinant and native enzyme parameters

Sample comparative data representation:

ParameterNative MT-CO2Recombinant MT-CO2Statistical Significance
Km (μM)X.X ± Y.YX.X ± Y.Yp-value
kcat (s⁻¹)X.X ± Y.YX.X ± Y.Yp-value
kcat/Km (M⁻¹s⁻¹)X.X × 10⁶ ± Y.YX.X × 10⁶ ± Y.Yp-value
Thermal stability (T₅₀, °C)X.X ± Y.YX.X ± Y.Yp-value
pH optimumX.X ± Y.YX.X ± Y.Yp-value

When differences are observed, researchers should investigate potential causes, including structural variations, post-translational modifications, or effects of purification tags .

What analytical approaches can help identify and resolve structural differences between recombinant and native MT-CO2?

When structural differences are detected between recombinant and native MT-CO2, several analytical approaches can help identify and address these discrepancies:

Resolution Strategies:

  • Optimize expression conditions to promote proper folding and assembly

  • Add cofactors or binding partners during purification or refolding

  • Engineer expression constructs to include critical post-translational modifications

  • Develop reconstitution protocols that incorporate other subunits of the cytochrome c oxidase complex

  • Consider alternative host systems that better match the protein's native environment

The integration of multiple analytical approaches provides complementary information that can guide structure-based optimization of recombinant protein production .

How can structural insights from recombinant MT-CO2 contribute to understanding evolutionary adaptations in Daubentonia madagascariensis?

Structural analysis of recombinant Daubentonia madagascariensis MT-CO2 can provide valuable insights into the evolutionary adaptations of this enigmatic primate species:

  • Comparative Sequence-Structure-Function Analysis:

    • Alignment of MT-CO2 sequences across primates to identify unique substitutions in the aye-aye lineage

    • Correlation of amino acid differences with structural features and functional properties

    • Identification of positively selected sites that may reflect adaptive evolution

  • Metabolic Adaptation Insights:

    • Analysis of enzyme kinetics under varying temperature and pH conditions to understand adaptations to the aye-aye's nocturnal lifestyle

    • Evaluation of substrate specificity differences that might reflect metabolic adaptations

    • Investigation of potential adaptations in electron transfer efficiency related to the species' unique ecological niche

  • Integration with Physiological Data:

    • Correlation of MT-CO2 properties with metabolic rate measurements from living aye-ayes

    • Investigation of potential adaptations related to the high energy demands of the aye-aye's specialized foraging behavior

    • Analysis of thermal stability properties that might reflect adaptation to Madagascar's climate

  • Molecular Clock Applications:

    • Using structural constraints on MT-CO2 to refine molecular dating of divergence times

    • Identification of functionally constrained regions versus rapidly evolving sites

    • Development of more accurate models of protein evolution for mitochondrial proteins

Through these approaches, recombinant MT-CO2 can serve as a molecular window into the evolutionary history and ecological adaptations of Daubentonia madagascariensis, potentially revealing how changes in this essential respiratory enzyme contributed to the species' unique adaptations .

What methodological approaches can be used to study the effects of mutations on MT-CO2 function and stability?

Investigating the effects of mutations on MT-CO2 function and stability requires a multifaceted approach combining genetic, biochemical, and biophysical methods:

  • Mutation Design Strategies:

    • Site-directed mutagenesis targeting conserved residues identified through sequence alignment

    • Alanine-scanning mutagenesis of functional domains

    • Introduction of naturally occurring mutations identified in related species

    • Creation of chimeric proteins by swapping domains between species

  • Expression and Purification of Mutant Variants:

    • Parallel expression and purification of wild-type and mutant proteins under identical conditions

    • Quantitative assessment of expression yields and solubility

    • Evaluation of purification behavior as an initial indicator of structural changes

  • Stability Assessment:

    • Thermal denaturation studies using differential scanning calorimetry or thermal shift assays

    • Chemical denaturation with urea or guanidinium chloride

    • Limited proteolysis to identify regions with altered structural stability

    • Long-term storage stability at various temperatures

  • Functional Characterization:

    • Detailed enzyme kinetics under standard and varying conditions

    • Spectroscopic analysis of cofactor binding (copper, heme)

    • Evaluation of protein-protein interactions with other cytochrome c oxidase subunits

    • Membrane integration efficiency for transmembrane domain mutations

  • Structure-Function Correlation:

    • Structural modeling to predict the impact of mutations

    • Correlation of observed functional changes with structural alterations

    • Identification of functional compensation mechanisms in the mutant proteins

Case Study Example: Mutations in the first N-terminal membrane-spanning region, similar to the T7671A mutation described in human patients, could be introduced into recombinant aye-aye MT-CO2 to assess impacts on protein stability and function. This approach could reveal whether similar functional dependencies exist across evolutionarily distant species and provide insights into the structural basis of disease-causing mutations .

How can researchers leverage recombinant MT-CO2 to develop novel applications in bioenergy or environmental monitoring?

Recombinant MT-CO2 offers potential applications beyond basic research that span bioenergy, biosensing, and environmental monitoring:

  • Bioenergy Applications:

    • Development of MT-CO2-based biocathodes for enzymatic fuel cells

    • Engineering enhanced electron transfer capabilities through protein engineering

    • Creation of hybrid systems coupling MT-CO2 with photosynthetic proteins for light-driven energy generation

    • Integration into bioinspired artificial respiratory chains for bioenergy applications

  • Biosensing Platforms:

    • Development of MT-CO2-based oxygen sensors for environmental monitoring

    • Creation of biosensors for detecting inhibitors of respiratory function in environmental samples

    • Design of whole-cell biosensors incorporating engineered MT-CO2 variants sensitive to specific pollutants

    • Integration with electrochemical detection systems for quantitative environmental analysis

  • Environmental Toxicity Screening:

    • Utilization of purified MT-CO2 as a biomarker for assessing the impact of environmental toxicants on respiratory function

    • Development of high-throughput screening platforms for identifying compounds that interfere with mitochondrial function

    • Creation of standardized assays for evaluating mitochondrial toxicity of environmental samples

  • Space Biomanufacturing Applications:

    • Integration of MT-CO2 production into CO2-based manufacturing systems for space applications

    • Development of compact bioreactors leveraging MT-CO2 for oxygen generation in closed systems

    • Engineering MT-CO2 variants with enhanced stability for extreme environments encountered in space missions

  • Research Tool Development:

    • Creation of fluorescently labeled MT-CO2 variants for studying mitochondrial dynamics

    • Development of affinity-tagged versions for pulling down interaction partners

    • Engineering split-protein complementation systems based on MT-CO2 for studying protein-protein interactions in vivo

These applications would require significant protein engineering and optimization of the recombinant production system, but they represent promising directions for translating fundamental research on this mitochondrial enzyme into practical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.