Recombinant Daubentonia madagascariensis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Daubentonia madagascariensis NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Daubentonia madagascariensis (aye-aye) NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein produced to study the structure and function of mitochondrial Complex I. This subunit is critical for electron transport chain activity, facilitating ATP synthesis through NADH oxidation and ubiquinone reduction . The recombinant form enables biochemical and structural analyses without requiring native mitochondrial extraction .

Biological Role of MT-ND4L

MT-ND4L is a hydrophobic core subunit of mitochondrial Complex I (NADH dehydrogenase), part of the membrane arm involved in proton translocation . Key functions include:

  • Electron Transfer: Mediates electron flow from NADH to ubiquinone, initiating the proton-pumping mechanism .

  • Structural Stability: Essential for the assembly of the 950 kDa Complex I structure .

  • Disease Association: Mutations in homologous human MT-ND4L are linked to Leber’s Hereditary Optic Neuropathy (LHON) and metabolic disorders .

Research Applications

This recombinant protein is utilized in:

  • Enzyme Activity Assays: Studying NADH dehydrogenase function and inhibition mechanisms (e.g., piericidin A binding) .

  • Structural Studies: Cryo-EM analyses of Complex I’s membrane domain and ubiquinone-binding channel .

  • Disease Modeling: Investigating mitochondrial dysfunction in LHON and metabolic syndromes using species homologs .

Comparative Insights

The Daubentonia madagascariensis MT-ND4L shares 87% sequence homology with the human variant (Uniprot P03901). Critical differences include:

FeatureD. madagascariensis MT-ND4LHuman MT-ND4L
Amino Acid Length9898
Key Mutation SitesNone reportedVal65Ala (LHON-linked)
Structural Overlap7-nucleotide overlap with ND4Identical gene overlap

These variations highlight evolutionary conservation but also species-specific adaptations in Complex I function .

Production and Quality Control

The recombinant protein is synthesized via mammalian or yeast expression systems, followed by:

  • Chromatography: Affinity and size-exclusion purification for high specificity .

  • Validation: Mass spectrometry and enzymatic activity assays confirm identity and functionality .

  • Stability: Lyophilized forms retain activity for 12 months at -80°C .

Challenges and Future Directions

While recombinant MT-ND4L enables detailed mechanistic studies, limitations persist:

  • Hydrophobicity: Requires detergent stabilization for in vitro studies .

  • Complex Assembly: Co-expression with other Complex I subunits is often necessary for functional reconstitution .
    Current research focuses on engineering soluble variants and cryo-EM-guided drug design for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format preferences. Please indicate your requirements during order placement, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which serves as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Daubentonia madagascariensis (Aye-aye) (Sciurus madagascariensis)
Target Names
Target Protein Sequence
MPLISINLSLAFTTALLGVLMFRSHLMSSLLCLEGTMLSMFILTTLSTLNLHYNLSSTLP IILLVFAACEAAAGLALLVTVSNTYGLDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Its function is to catalyze electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of MT-ND4L in mitochondrial respiration?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) functions as a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It forms part of the enzyme membrane arm embedded in the lipid bilayer and is critically involved in proton translocation .

The protein's primary function is contributing to the first step in the electron transport process during oxidative phosphorylation, which ultimately leads to ATP production. Within mitochondria, Complex I creates an unequal electrical charge on either side of the inner mitochondrial membrane through step-by-step transfer of electrons, providing energy for ATP production .

What are the recognized domains and functional regions of MT-ND4L?

MT-ND4L contains domains classified as "NADH dehydrogenase subunit 4L" according to the Conserved Domain Database (CDD). The protein is highly hydrophobic, containing multiple transmembrane regions that anchor it within the inner mitochondrial membrane . These hydrophobic domains are essential for the assembly of the entire Complex I structure, as demonstrated in studies where absence of ND4L prevents the assembly of the 950-kDa whole complex and suppresses enzyme activity .

What expression systems are most effective for producing recombinant MT-ND4L from Daubentonia madagascariensis?

Expression of highly hydrophobic mitochondrial membrane proteins like MT-ND4L presents significant challenges. Based on studies with other ND subunits, researchers should consider:

  • Bacterial expression systems: E. coli strains designed for membrane protein expression (C41/C43) with specialized vectors containing solubility-enhancing fusion partners.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae can provide a eukaryotic environment more suitable for proper folding.

  • Cell-free expression systems: These can be particularly valuable for toxic membrane proteins that may impair host cell viability .

The unique challenge with Daubentonia madagascariensis MT-ND4L would be optimizing codon usage and reducing hydrophobicity in critical regions to enhance expression while maintaining structural integrity and function.

What purification strategies overcome the challenges of working with highly hydrophobic MT-ND4L?

Purification of recombinant MT-ND4L requires specialized approaches due to its extreme hydrophobicity:

  • Detergent screening: Systematic evaluation of mild detergents (DDM, LMNG, digitonin) to solubilize the protein without denaturation.

  • Affinity tags placement: Strategic positioning of affinity tags (His, FLAG, etc.) to avoid interference with protein folding, typically at the N-terminus with appropriate linkers.

  • Size exclusion chromatography: Critical for separating properly folded protein from aggregates and for detergent exchange.

  • Lipid reconstitution: Incorporation into nanodiscs or liposomes to maintain native-like environment during functional studies .

Careful monitoring of protein quality at each purification step using techniques like CD spectroscopy and SEC-MALS is essential to ensure structural integrity.

What methodologies are most effective for assessing MT-ND4L integration into Complex I?

Researchers can employ several complementary approaches to verify proper integration:

  • Blue Native PAGE: Allows visualization of intact Complex I assembly and can be followed by Western blotting to confirm MT-ND4L incorporation.

  • Proteoliposome reconstitution: Reconstituting purified components into liposomes to assess functional assembly.

  • Cryo-EM analysis: For high-resolution structural characterization of the integrated subunit within the complex.

  • NADH:ubiquinone oxidoreductase activity assays: Quantitative measurement of electron transfer rates to assess functional integration .

The absence of properly integrated MT-ND4L would prevent the assembly of the whole 950-kDa Complex I and eliminate enzyme activity, providing a clear functional readout for successful incorporation .

How can researchers distinguish between assembly defects and catalytic defects when studying MT-ND4L mutations?

Distinguishing between these defect types requires a multi-faceted experimental approach:

  • Assembly analysis:

    • Blue Native PAGE to visualize complex assembly intermediates

    • Density gradient centrifugation to separate assembly intermediates

    • Co-immunoprecipitation to map interaction partners

  • Catalytic activity assessment:

    • Spectrophotometric assays measuring NADH oxidation

    • Measurement of proton pumping using pH-sensitive fluorescent dyes

    • Coenzyme Q reduction kinetics in assembled complexes

  • Structural analysis:

    • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

    • Site-directed crosslinking to map intersubunit contacts

By implementing this systematic approach, researchers can determine whether a mutation primarily affects assembly (resulting in decreased complex formation) or catalytic function (showing normal assembly but impaired activity).

How is MT-ND4L implicated in neurodegenerative disorders, and what experimental models best capture these associations?

Recent research has identified significant connections between MT-ND4L variants and neurodegenerative conditions:

  • Alzheimer's Disease: Analysis of 4220 mtDNA variants revealed study-wide significant association of AD with a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10^-5) as well as with MT-ND4L in a gene-based test (P = 6.71 × 10^-5) .

  • Leber hereditary optic neuropathy (LHON): A mutation in the MT-ND4L gene (T10663C or Val65Ala) has been identified in several families with LHON, changing valine to alanine at position 65 .

Experimental models to study these associations include:

  • Cybrid cell lines: Patient-derived mitochondria with MT-ND4L mutations can be introduced into ρ⁰ cells (lacking mtDNA) to study functional consequences.

  • CRISPR-engineered animal models: Introducing specific MT-ND4L variants into model organisms.

  • iPSC-derived neurons: Patient-specific induced pluripotent stem cells differentiated into neurons provide a disease-relevant cellular context .

What is the significance of the rs28709356 C>T variant in MT-ND4L for Alzheimer's disease research?

The rs28709356 C>T variant in MT-ND4L shows a significant association with Alzheimer's disease risk (P = 7.3 × 10^-5), with studies demonstrating its presence in whole exome sequencing data from the Alzheimer's Disease Sequencing Project (ADSP) . This finding provides compelling evidence for mitochondrial dysfunction in AD pathogenesis.

Researchers investigating this variant should:

  • Characterize its biochemical effects on Complex I assembly and function

  • Examine its impact on ROS production and oxidative stress markers

  • Assess mitochondrial membrane potential and ATP production in cellular models

  • Investigate potential synergistic effects with nuclear-encoded mitochondrial genes like TAMM41

  • Evaluate its frequency in different populations and potential association with disease progression rates

This variant represents a valuable target for developing mitochondria-targeted therapeutic strategies for Alzheimer's disease.

What evolutionary insights can be gained from studying MT-ND4L gene migration to the nuclear genome in certain species?

The evolutionary transition of MT-ND4L from mitochondrial to nuclear encoding in certain species provides fascinating research opportunities:

In the unicellular green alga Chlamydomonas reinhardtii, unlike in vascular plants, fungi, and animals, the ND3 and ND4L subunits are encoded in the nuclear genome (genes NUO3 and NUO11) . This nuclear encoding required evolutionary adaptations:

  • Reduced hydrophobicity: Nuclear-encoded ND4L shows lower hydrophobicity compared to mitochondrion-encoded counterparts, facilitating import into mitochondria.

  • Import mechanisms: Special features facilitate expression and proper import of these highly hydrophobic proteins into mitochondria.

  • Codon optimization: Nuclear encoding necessitates adaptation to nuclear codon usage patterns versus mitochondrial patterns.

Studying these adaptations in different species provides insights into the evolutionary pressures driving gene transfer between organellar and nuclear genomes and the molecular mechanisms facilitating such transfers .

How do structural adaptations in MT-ND4L differ between species with varying metabolic demands?

Species with different metabolic requirements show adaptations in MT-ND4L structure that reflect their energetic demands:

  • High-metabolism species (like certain bats, hummingbirds) may show modifications in proton-pumping regions to enhance energy production efficiency.

  • Hypoxia-adapted species (diving mammals, high-altitude primates) often display mutations that optimize Complex I function under low-oxygen conditions.

  • Cold-adapted species exhibit amino acid substitutions that maintain protein flexibility at lower temperatures.

Research approaches to study these adaptations include:

  • Comparative sequence analysis across species with known metabolic parameters

  • Homology modeling to predict structural consequences of sequence variations

  • Functional characterization using recombinant proteins or cybrid approaches

  • Correlation of specific amino acid changes with metabolic rates and environmental adaptations

What strategies can overcome the challenges of antibody development for highly conserved MT-ND4L epitopes?

Developing specific antibodies against MT-ND4L presents challenges due to its high conservation across species and extreme hydrophobicity. Researchers should consider:

  • Peptide design strategy:

    • Target less conserved regions between species for species-specific antibodies

    • Select moderately hydrophilic loops or termini accessible in the native protein

    • Use multiple prediction algorithms to identify optimal epitopes

  • Antibody production approaches:

    • Genetic immunization with MT-ND4L DNA constructs rather than protein/peptide immunization

    • Phage display technology to select antibodies with desired specificity

    • Single-domain antibodies (nanobodies) that may access epitopes conventional antibodies cannot reach

  • Validation methods:

    • Use MT-ND4L knockout/silenced samples as negative controls

    • Perform epitope mapping to confirm specificity

    • Validate across multiple techniques (Western blot, immunoprecipitation, immunofluorescence)

How can researchers design robust controls to validate MT-ND4L functional assays?

Proper experimental controls are critical for MT-ND4L functional studies:

  • Positive controls:

    • Well-characterized MT-ND4L from model organisms (human, mouse)

    • Synthetic peptides mimicking functional domains

    • Purified native Complex I as activity benchmark

  • Negative controls:

    • MT-ND4L knockout/silenced samples

    • MT-ND4L with known inactivating mutations

    • Complex I inhibitors (rotenone, piericidin A) to establish baseline

  • Validation approaches:

    • Multiple complementary assays measuring different aspects of function

    • Dose-response studies with inhibitors

    • Rescue experiments with wild-type MT-ND4L

  • Technical considerations:

    • Account for background NADH oxidation not related to Complex I

    • Control for variations in mitochondrial content

    • Normalize activity to assembled complex levels rather than total protein

What emerging technologies will advance structure-function studies of MT-ND4L in Complex I?

Several cutting-edge technologies are transforming our ability to study Complex I subunits like MT-ND4L:

  • Cryo-electron microscopy: Advancing to atomic resolution for membrane proteins, allowing visualization of MT-ND4L in its native context without crystallization.

  • Integrative structural biology: Combining cryo-EM with mass spectrometry, crosslinking, and molecular dynamics simulations for complete structural characterization.

  • In-cell NMR spectroscopy: Enabling structural studies of MT-ND4L in living cells.

  • Time-resolved structural methods: Capturing conformational changes during catalytic cycles.

  • AlphaFold2 and other AI approaches: Improving prediction of protein-protein interactions and complex assembly.

  • Single-molecule functional assays: Measuring proton pumping and electron transfer at the single-molecule level .

These technologies will help resolve longstanding questions about the precise role of MT-ND4L in the proton-pumping mechanism of Complex I.

How might gene therapy approaches targeting MT-ND4L evolve for mitochondrial disease treatment?

Developing gene therapies for MT-ND4L-related diseases faces unique challenges but shows promising advances:

  • Delivery strategies:

    • Mitochondria-targeted adeno-associated virus (AAV) vectors

    • Allotopic expression (nuclear expression with mitochondrial targeting)

    • RNA therapeutic approaches for mutation-specific targeting

  • Editing approaches:

    • Base editors modified for mitochondrial localization

    • Mitochondrial-targeted CRISPR systems

    • Heteroplasmy shifting to increase wild-type mtDNA proportion

  • Alternative strategies:

    • Nuclear transfer to replace mutated mitochondria

    • Xenotopic expression of fungal or algal alternative oxidases as bypass therapy

    • Small molecules to enhance residual Complex I function

  • Clinical development pathway:

    • Initial focus on Leber hereditary optic neuropathy models

    • Expansion to neurodegenerative conditions with MT-ND4L involvement

    • Development of mitochondrial-specific biomarkers for clinical trials

Recent success with gene therapy for other mitochondrial disease genes suggests these approaches may become viable for MT-ND4L-related conditions in the coming decade.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.