Recombinant Daucus carota 14 kDa proline-rich protein DC2.15

What is the complete amino acid sequence of Daucus carota 14 kDa proline-rich protein DC2.15?

The complete amino acid sequence of the mature Daucus carota 14 kDa proline-rich protein DC2.15 (UniProt P14009) is: TEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALKLGVCADVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFECT. This sequence corresponds to the expression region 26-137, representing the full-length protein without the signal peptide . Understanding this sequence is essential for designing experiments involving recombinant expression, structural studies, and functional analysis.

How is the recombinant version of Daucus carota 14 kDa proline-rich protein DC2.15 typically produced?

Recombinant Daucus carota 14 kDa proline-rich protein DC2.15 is typically produced using E. coli expression systems with a His-tag to facilitate purification . The process generally involves:

• Cloning the coding sequence into a suitable expression vector

• Transformation into E. coli expression strains

• Induction of protein expression

• Cell lysis and protein extraction

• Affinity chromatography purification using the His-tag

• Buffer exchange and storage in Tris-based buffer with 50% glycerol

This approach yields the full-length mature protein (amino acids 26-137) in a functional form suitable for various research applications.

What is the predicted structural domain organization of the DC2.15 protein?

The Daucus carota 14 kDa proline-rich protein DC2.15 features several distinctive structural elements:

• A proline-rich region, as indicated by the repeating proline residues (PKPKPKPTPKPTPTP) in the N-terminal region

• Cysteine-rich motifs that suggest the formation of disulfide bonds important for tertiary structure

• Two conserved domains: a central hydrophobic core (GVCADVLNLVHNVVIG) and a C-terminal region (VCLCTAIKANILGKNLNLPIALSLVLNN)

These structural features suggest that DC2.15 likely adopts a globular structure with extended proline-rich regions, which may play a role in protein-protein interactions or cell wall association in plants. The relatively high content of proline residues affects the protein's conformation and likely contributes to its biological function in plant tissues.

How is the expression of DC2.15 regulated during plant defense responses?

The expression of proline-rich proteins like DC2.15 is significantly upregulated during plant defense responses. Research has shown that in pepper plants, a homologous protein (CaPRP-DC2.15) showed substantial upregulation (6.73 log2 fold change) following pathogen inoculation with ObPV . This upregulation pattern indicates that:

• The gene is responsive to biotic stress signaling pathways

• Expression is likely regulated by defense-related transcription factors

• The protein plays a role in the plant's immune response

Additionally, the protein shows moderate upregulation (3.98 log2 fold change) in response to ethephon treatment, suggesting that its expression is also influenced by ethylene-mediated signaling pathways that are critical in plant stress responses . This dual responsiveness to both pathogen challenge and hormonal signals points to a complex regulatory network controlling DC2.15 expression.

What are the tissue-specific expression patterns of DC2.15 in Daucus carota?

While the search results don't explicitly detail the tissue-specific expression patterns, research on similar proline-rich proteins suggests that DC2.15 likely shows differential expression across various carrot tissues. Based on its characteristics and the biology of similar proteins, researchers should consider:

• Higher expression levels might be expected in outer tissues (epidermis, periderm) that serve as first-line defenses against pathogens

• Expression is likely developmental stage-dependent, possibly increasing during root maturation

• Chromoplast-associated expression may occur, given the protein's presence in carrot root tissues that contain high levels of carotenoid-accumulating chromoplasts

Studying the tissue-specific localization requires techniques such as in situ hybridization or tissue-specific transcriptomics to accurately map expression patterns throughout the plant's development and in response to various environmental stimuli.

What are the recommended protocols for isolating native DC2.15 protein from carrot tissues?

Isolation of native DC2.15 protein from carrot tissues requires a carefully optimized protocol:

• Tissue homogenization: Fresh carrot tissue should be flash-frozen in liquid nitrogen and ground to a fine powder.

• Protein extraction: Homogenized tissue is mixed with extraction buffer (typically 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 1% Triton X-100, and protease inhibitor cocktail).

• Differential centrifugation: Initial centrifugation at 10,000 × g to remove debris, followed by ultracentrifugation if subcellular fractionation is desired.

• Purification steps:

  • Ion exchange chromatography (taking advantage of DC2.15's pI characteristics)

  • Gel filtration chromatography to separate proteins by molecular weight

  • Immunoaffinity chromatography using antibodies specific to DC2.15

This approach parallels methods used for isolating other plant proteins from carrot tissues, such as the carotenoprotein complex isolation described in the research literature , but with modifications specific to proline-rich protein characteristics.

What are the optimal storage conditions for maintaining the stability of recombinant DC2.15?

The optimal storage conditions for recombinant DC2.15 protein are:

• Long-term storage: -20°C or -80°C in a Tris-based buffer containing 50% glycerol

• Working aliquots: 4°C for up to one week

• Freeze-thaw cycles: Should be minimized; repeated freezing and thawing is not recommended

To maintain protein stability, researchers should:

• Prepare small working aliquots to avoid repeated freeze-thaw cycles

• Ensure sterile handling conditions to prevent contamination

• Add appropriate protease inhibitors if proteolytic degradation is a concern

• Monitor protein integrity periodically through SDS-PAGE or other analytical methods

These storage recommendations align with standard practices for recombinant proteins while addressing the specific needs of DC2.15.

What analytical techniques are most effective for characterizing DC2.15 protein-protein interactions?

Several analytical techniques are particularly effective for characterizing DC2.15 protein-protein interactions:

• Co-immunoprecipitation (Co-IP): Useful for identifying in vivo interaction partners by using antibodies against DC2.15 to pull down protein complexes from plant extracts.

• Yeast two-hybrid (Y2H) screening: Effective for identifying potential interaction partners by expressing DC2.15 as a bait protein.

• Surface plasmon resonance (SPR): Provides quantitative binding kinetics data for interactions between DC2.15 and potential partners.

• Isothermal titration calorimetry (ITC): Measures the thermodynamic parameters of binding interactions.

• Proximity labeling approaches (BioID or APEX): Can capture weak or transient interactions by tagging proteins in close proximity to DC2.15 in vivo.

These approaches would be particularly valuable for understanding how DC2.15 may interact with other defense-related proteins, given its upregulation during pathogen responses . When designing these experiments, researchers should consider the proline-rich regions, which often mediate protein-protein interactions in plant systems.

How can CRISPR/Cas9 gene editing be applied to study DC2.15 function in planta?

CRISPR/Cas9 gene editing provides powerful approaches for studying DC2.15 function in carrot plants:

• Knockout strategies:

  • Design sgRNAs targeting conserved regions of the DC2.15 gene

  • Create complete knockouts to analyze loss-of-function phenotypes

  • Generate tissue-specific knockouts using promoter-specific Cas9 expression

• Promoter modifications:

  • Target regulatory regions to alter expression patterns

  • Introduce reporter genes (GFP, LUC) for real-time monitoring of expression

• Domain-specific modifications:

  • Create precise mutations in functional domains to assess their importance

  • Generate truncated versions to determine domain-specific functions

• Phenotypic analysis:

  • Evaluate pathogen susceptibility in edited plants

  • Assess developmental phenotypes

  • Analyze changes in cell wall composition and structure

When implementing CRISPR/Cas9 editing in carrots, researchers should consider transformation efficiency, regeneration protocols specific to Daucus carota, and appropriate screening methods for identifying successful edits in this species.

What approaches are recommended for investigating the role of DC2.15 in plant immunity?

To investigate the role of DC2.15 in plant immunity, researchers should consider a multi-faceted approach:

• Expression analysis under diverse pathogen challenges:

  • Quantify DC2.15 transcript levels using qRT-PCR following inoculation with different pathogens

  • Perform time-course analysis to capture the dynamics of expression changes

  • Compare expression patterns in resistant versus susceptible plant varieties

• Genetic manipulation:

  • Generate DC2.15 overexpression lines and assess altered pathogen resistance

  • Create RNAi or CRISPR knockout lines to evaluate loss-of-function effects

  • Analyze cross-species complementation using DC2.15 homologs

• Cellular localization studies:

  • Create fluorescent protein fusions to track DC2.15 localization during infection

  • Perform co-localization studies with known defense components

  • Analyze changes in localization patterns following pathogen perception

• Biochemical analysis:

  • Investigate post-translational modifications occurring during immune responses

  • Identify interaction partners specific to immunity contexts

  • Assess changes in protein stability during defense responses

The significant upregulation of the DC2.15 homolog in pepper during pathogen challenge (6.73 log2 fold change) suggests that this protein likely plays an important role in plant defense mechanisms, making these approaches particularly valuable.

How can structural biology techniques be applied to understand DC2.15 function?

Structural biology techniques offer valuable insights into DC2.15 function:

• X-ray crystallography:

  • Determine high-resolution 3D structure of DC2.15

  • Co-crystallize with interaction partners to reveal binding interfaces

  • Challenges include obtaining sufficient quantities of purified protein and growing diffraction-quality crystals

• NMR spectroscopy:

  • Analyze solution structure, particularly suitable for the potentially flexible proline-rich regions

  • Investigate dynamic properties and conformational changes

  • Study protein-ligand interactions in solution

• Cryo-electron microscopy:

  • Visualize larger complexes involving DC2.15

  • Study structural arrangements in membrane or cell wall contexts

  • Benefit from minimal sample preparation requirements

• Computational approaches:

  • Generate homology models based on related proteins

  • Perform molecular dynamics simulations to predict functional movements

  • Use molecular docking to predict interaction interfaces

These structural studies would help elucidate how the distinctive proline-rich regions and the conserved domains of DC2.15 contribute to its biological function, particularly in the context of plant defense responses where it shows significant upregulation .

How should researchers interpret contradictory results between in vitro and in planta studies of DC2.15?

When encountering contradictory results between in vitro and in planta studies of DC2.15, researchers should:

• Analyze experimental conditions systematically:

  • Compare protein concentrations used in different studies

  • Evaluate buffer compositions and their physiological relevance

  • Consider post-translational modifications present in native but not recombinant proteins

• Address biological context:

  • In planta studies include complex regulatory networks absent in vitro

  • Cell/tissue-specific effects may dilute observable phenotypes in whole-plant studies

  • Temporal dynamics of responses differ significantly between systems

• Reconcile findings through complementary approaches:

  • Use semi-in vitro systems (e.g., isolated protoplasts, microsomal fractions)

  • Develop reconstituted systems that incorporate key interacting partners

  • Employ dose-response studies to identify threshold effects

• Consider evolutionary context:

  • Analyze functions of homologous proteins across species

  • Investigate specialized vs. conserved functions that might explain discrepancies

This systematic approach to analyzing contradictory results recognizes that proteins like DC2.15, which function in complex defense response networks, often show context-dependent activities that may not be fully recapitulated in simplified experimental systems.

What statistical approaches are most appropriate for analyzing differential expression data of DC2.15 across experimental conditions?

For analyzing differential expression data of DC2.15 across experimental conditions, researchers should consider these statistical approaches:

• For RNA-Seq data analysis:

  • Normalization methods: TPM, RPKM/FPKM, or preferably DESeq2/edgeR normalization

  • Statistical testing: Negative binomial distribution models (as used in DESeq2, edgeR)

  • Multiple testing correction: Benjamini-Hochberg procedure to control false discovery rate

  • Log2 fold change thresholds: Consider biological significance (typically >1.5-2 for meaningful changes)

• For time-series experiments:

  • ANOVA with repeated measures for parametric analysis

  • Friedman test for non-parametric analysis of time-series data

  • Mixed-effects models to account for both fixed and random effects

• For multi-factorial designs:

  • Two-way or multi-way ANOVA to assess interaction effects

  • General linear models to incorporate continuous covariates

  • Post-hoc tests (Tukey's HSD, Dunnett's test) for specific comparisons

• Visualization approaches:

  • Heatmaps with hierarchical clustering

  • Principal component analysis to identify patterns

  • Volcano plots highlighting both statistical significance and fold change

When interpreting results, researchers should consider that significant upregulation, such as the 6.73 log2 fold change observed for the DC2.15 homolog in pepper , indicates strong biological relevance in the experimental context.

How can researchers effectively compare homologs of DC2.15 across different plant species?

To effectively compare DC2.15 homologs across different plant species:

• Sequence analysis approaches:

  • Multiple sequence alignment (MUSCLE, CLUSTAL Omega) to identify conserved motifs

  • Phylogenetic reconstruction (Maximum Likelihood, Bayesian) to establish evolutionary relationships

  • Selection analysis (dN/dS ratios) to identify sites under positive or purifying selection

  • Domain architecture comparison to detect functional innovations

• Expression pattern comparison:

  • Meta-analysis of transcriptomic datasets across species

  • Standardization techniques to allow cross-species comparisons

  • Orthology-based mapping of expression data across species

• Functional conservation testing:

  • Heterologous expression systems to test functional complementation

  • Cross-species promoter activity analysis

  • Comparative interaction network mapping

• Data integration and visualization:

  • Circos plots for genome-wide synteny analysis

  • Interactive phylogenetic trees with mapped functional data

  • Comparative co-expression network visualization

This multi-faceted approach would be particularly valuable given the identification of DC2.15 homologs in diverse plant species, such as the homolog identified in pepper (CaPRP-DC2.15) that shows significant upregulation during pathogen response , suggesting evolutionary conservation of function in plant immunity across different species.