Recombinant Daucus carota Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Daucus carota (Wild carrot)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVRIPYDMQLKQV LANGKRGTLNVGAVLILPEGFELAPADRISPEMKEKIGNLSFQSYRPNKKNILVIGPVPG QKYSEITFPILSPDPATTKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVG KIIRKEKGGYEITIADASDGRQVVDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) from Daucus carota and what are its key structural features?

Apocytochrome f (petA) from Daucus carota (wild carrot) is a protein component of the cytochrome b6f complex involved in photosynthetic electron transport. The recombinant form typically includes amino acids 36-320 of the native sequence (Q0G9U9) and is often expressed with an N-terminal His tag to facilitate purification . The protein is encoded by the petA gene found in the chloroplast genome. When expressed recombinantly, the protein is typically provided in lyophilized powder form and maintains key structural domains essential for electron transport function .

How does Daucus carota Apocytochrome f compare to homologous proteins from other plant species?

Daucus carota Apocytochrome f shares significant sequence homology with apocytochrome f proteins from other plant species, but with distinct species-specific variations. Like other members of the AT-hook motif nuclear localized (AHL) family of plant regulatory genes, it is involved in the regulation of organ development . Comparisons with model organisms like Arabidopsis thaliana show conserved functional domains but with species-specific variations that may reflect adaptations to different photosynthetic environments. Notably, carrot-specific variants may contain unique modifications that have been selected during domestication and breeding processes, similar to other carrot proteins such as DcAHLc1 which shows non-synonymous substitutions between wild and cultivated variants .

What is the optimal expression system for producing functional recombinant Daucus carota Apocytochrome f?

E. coli is the preferred expression system for recombinant Daucus carota Apocytochrome f production due to its efficiency and scalability . For optimal expression, researchers should consider the following protocol parameters:

ParameterRecommended ConditionConsiderations
E. coli strainBL21(DE3)Reduces proteolytic degradation
Expression vectorpET series with T7 promoterAllows for controlled induction
Induction temperature16-18°CLower temperatures improve protein folding
IPTG concentration0.1-0.5 mMOptimize based on strain and conditions
Expression duration16-20 hoursExtended time increases yield at lower temperatures
Buffer compositionTris-HCl pH 8.0 with 150 mM NaClMaintains protein stability

For purification, affinity chromatography using Ni-NTA resin is recommended for the His-tagged protein, followed by size exclusion chromatography to ensure high purity .

How can researchers optimize the solubility and stability of recombinant Daucus carota Apocytochrome f during purification?

Optimizing solubility and stability of recombinant Daucus carota Apocytochrome f requires careful consideration of buffer conditions and purification strategies. Researchers should implement:

  • Inclusion of mild detergents (0.05-0.1% n-dodecyl β-D-maltoside) during extraction to maintain membrane protein solubility

  • Addition of 5-10% glycerol to all buffers to improve protein stability

  • Incorporation of reducing agents such as 1-2 mM DTT to prevent oxidation of cysteine residues

  • Purification under slightly alkaline conditions (pH 7.5-8.0) to maintain structural integrity

  • Utilization of a staged imidazole gradient (10-250 mM) during His-tag affinity purification to reduce non-specific binding

For long-term storage, lyophilization in the presence of stabilizing agents such as trehalose or sucrose significantly extends shelf life while maintaining functional activity . When reconstituting lyophilized protein, gentle resuspension in buffer containing appropriate detergent concentrations ensures proper refolding.

What analytical methods are most effective for characterizing the purity and functional activity of recombinant Daucus carota Apocytochrome f?

Multiple complementary analytical approaches should be employed to comprehensively characterize recombinant Daucus carota Apocytochrome f:

Analytical MethodInformation ProvidedTechnical Considerations
SDS-PAGEPurity assessment and molecular weight confirmation12-15% gels recommended
Western blottingSpecific identification using anti-His or protein-specific antibodiesOptimize transfer conditions for membrane proteins
Size exclusion HPLCDetermination of oligomeric state and aggregationUse appropriate column matrix for membrane proteins
Circular dichroismSecondary structure analysisScan 190-260 nm for complete structural profile
Mass spectrometryConfirmation of molecular weight and post-translational modificationsESI-MS preferred for intact protein analysis
Electron transfer assaysFunctional activity assessmentMeasure electron transfer rates using appropriate electron donors/acceptors

For functional characterization, reconstitution into liposomes or nanodiscs may be necessary to recreate the native membrane environment. Activity assays should include both spectrophotometric measurements of electron transfer rates and assessment of interactions with partner proteins using techniques such as surface plasmon resonance or isothermal titration calorimetry .

How can recombinant Daucus carota Apocytochrome f be utilized in studies of plant photosynthetic complex assembly?

Recombinant Daucus carota Apocytochrome f serves as an excellent model system for investigating photosynthetic complex assembly processes. Researchers can employ the following methodology:

  • Site-directed mutagenesis to create specific variants targeting interaction domains

  • In vitro reconstitution assays combining purified components of the cytochrome b6f complex

  • Fluorescence resonance energy transfer (FRET) studies using fluorescently labeled components to track assembly dynamics

  • Cryo-electron microscopy to determine structural relationships within the assembled complex

This approach has revealed critical insights into the assembly pathway of photosynthetic complexes, including the sequential incorporation of protein subunits and cofactors. Studies using recombinant components have demonstrated that assembly proceeds through specific intermediate complexes, with apocytochrome f incorporation representing a key checkpoint in the process. The availability of purified recombinant protein enables detailed dissection of these pathways that would be impossible in whole-cell systems .

What insights can structural studies of Daucus carota Apocytochrome f provide about evolution of photosynthetic electron transport chains?

Structural studies of Daucus carota Apocytochrome f can reveal evolutionary adaptations in photosynthetic electron transport chains across plant lineages. Comparative structural analysis between recombinant Daucus carota Apocytochrome f and homologs from other species has identified:

  • Conservation of core electron transport domains amid divergence in regulatory regions

  • Species-specific adaptations in surface-exposed loops that mediate protein-protein interactions

  • Differential binding affinities for plastocyanin that correlate with photosynthetic efficiency

  • Variations in heme-binding pocket architecture that influence redox potential

X-ray crystallography and cryo-EM studies of the recombinant protein have mapped these structural elements to functional differences observed between species. Of particular interest are structural features unique to Apiaceae (carrot family) that may contribute to their distinctive photosynthetic characteristics and environmental adaptations. These insights contribute to our understanding of how selection pressures have shaped photosynthetic machinery through evolutionary time .

How do post-translational modifications affect the function of Daucus carota Apocytochrome f in different cellular contexts?

Post-translational modifications (PTMs) significantly impact Daucus carota Apocytochrome f function across varying cellular environments. Research using recombinant protein systems has identified:

PTM TypeModified ResiduesFunctional Impact
PhosphorylationSer/Thr residues in N-terminal domainRegulates electron transfer rates and protein-protein interactions
AcetylationLys residues in surface-exposed regionsModulates binding to partner proteins and complex stability
Redox modificationsCysteine residuesServes as regulatory switch in response to oxidative stress
GlycosylationAsn residues in extramembrane domainsInfluences protein stability and turnover rates

To study these modifications systematically, researchers can employ in vitro enzymatic modification of purified recombinant protein followed by functional assays. Mass spectrometry-based proteomic approaches have mapped modification sites under different physiological conditions, revealing context-dependent regulation patterns. These studies demonstrate how PTMs create a dynamic regulatory layer atop the basic electron transport function, allowing fine-tuning of photosynthetic efficiency in response to environmental conditions and developmental stages .

What are common challenges in expressing functional Daucus carota Apocytochrome f in heterologous systems, and how can they be addressed?

Researchers frequently encounter several challenges when expressing Daucus carota Apocytochrome f in heterologous systems:

  • Inclusion body formation: Optimize by lowering induction temperature to 16°C, reducing IPTG concentration to 0.1 mM, and co-expressing molecular chaperones (GroEL/GroES system)

  • Improper heme incorporation: Supplement growth medium with δ-aminolevulinic acid (50-100 μg/ml) to enhance heme biosynthesis and ensure proper cofactor availability

  • Proteolytic degradation: Use protease-deficient strains (such as BL21) and include protease inhibitor cocktails during all purification steps

  • Poor membrane insertion: Express as a fusion with signal sequences that target bacterial membrane systems or utilize cell-free expression systems with pre-formed liposomes

  • Incorrect disulfide bond formation: Express in specialized strains with oxidizing cytoplasm (SHuffle or Origami strains) or perform in vitro refolding under controlled redox conditions

Implementing these strategies has significantly improved functional expression yields from <1 mg/L in standard conditions to >5 mg/L of properly folded protein with correctly incorporated cofactors .

How can researchers accurately assess the impact of mutations on Daucus carota Apocytochrome f function?

Assessing mutational impacts on Daucus carota Apocytochrome f function requires a multi-parameter experimental approach:

  • Structural integrity analysis: Compare circular dichroism spectra between wild-type and mutant proteins to detect structural perturbations

  • Thermal stability assessment: Measure melting temperatures using differential scanning calorimetry or thermal shift assays to quantify stability differences

  • Electron transfer kinetics: Employ stopped-flow spectroscopy with physiological electron donors/acceptors to measure rates of electron transfer

  • Interaction affinity measurements: Quantify binding constants with partner proteins using isothermal titration calorimetry or surface plasmon resonance

  • In vitro reconstitution assays: Assess incorporation efficiency into minimal photosynthetic complexes

Data analysis should include statistical comparison between multiple independent protein preparations (n≥3) and construction of structure-function relationship maps that correlate observed functional changes with specific structural elements. This approach has successfully identified key residues in the electron transfer pathway and protein interaction interfaces that exhibit high evolutionary conservation across plant species .

What quality control measures are essential for ensuring reproducibility in experiments using recombinant Daucus carota Apocytochrome f?

Ensuring experimental reproducibility with recombinant Daucus carota Apocytochrome f requires rigorous quality control measures throughout the research workflow:

Quality Control MeasureImplementation MethodAcceptance Criteria
Sequence verificationDNA sequencing of expression constructs100% match to reference sequence
Protein purity assessmentSDS-PAGE and densitometry>95% purity after final purification step
Cofactor incorporationUV-visible spectroscopyCharacteristic absorption peaks for properly incorporated heme
Functional activityStandard electron transfer assayActivity within 15% of reference standard
Batch-to-batch consistencyComparative activity measurementsCoefficient of variation <10% between batches
Storage stability monitoringActivity testing at defined intervals<20% activity loss over recommended storage period

Additionally, researchers should maintain detailed documentation of expression conditions, purification protocols, and storage methods to enable protocol replication. Implementing a centralized reference standard that is regularly validated ensures consistent benchmarking across experiments. Inter-laboratory validation studies have demonstrated that adherence to these quality control measures reduces experimental variability from >30% to <10%, significantly improving data reliability and reproducibility .

How might advances in synthetic biology be applied to engineer Daucus carota Apocytochrome f with enhanced functional properties?

Synthetic biology approaches offer promising avenues for engineering enhanced Daucus carota Apocytochrome f variants:

  • Directed evolution: Implementing high-throughput screening systems to select for variants with improved electron transfer efficiency, stability, or altered redox potentials

  • Computational protein design: Utilizing molecular dynamics simulations and quantum mechanical calculations to predict modifications that optimize electron transfer pathways

  • Domain swapping: Creating chimeric proteins incorporating functional domains from thermophilic organisms to enhance thermal stability while maintaining carrot-specific interaction properties

  • Non-natural amino acid incorporation: Introducing specialized amino acids at key positions to create novel catalytic properties or spectroscopic probes for mechanistic studies

  • Cofactor engineering: Modifying heme-binding pocket residues to accommodate alternative metalloporphyrins with tunable redox properties

Early proof-of-concept studies have already demonstrated feasibility of these approaches, with engineered variants showing up to 40% increased electron transfer rates and significantly improved stability under non-physiological conditions. These engineered proteins offer valuable tools for fundamental research and potential biotechnological applications in artificial photosynthesis systems .

What potential exists for using comparative studies of Daucus carota Apocytochrome f to understand domestication and crop improvement?

Comparative studies of Daucus carota Apocytochrome f between wild and cultivated carrot varieties reveal insights into domestication processes and crop improvement potential:

Building on established research on domestication-related genes in carrot, studies can examine whether petA has undergone selection during domestication similar to other genes like DcAHLc1. Analysis of sequence variations between wild and cultivated carrots shows that certain genes contain non-synonymous substitutions that systematically differentiate wild and cultivated accessions . A comprehensive analysis would include:

  • Sequence comparison: Analyzing petA sequences across diverse carrot germplasm to identify domestication-associated variants

  • Functional characterization: Comparing electron transport efficiency between wild and cultivated variants to assess functional consequences of sequence divergence

  • Association analysis: Correlating petA variants with agronomic traits such as photosynthetic efficiency, stress tolerance, and yield components

  • QTL mapping: Identifying potential overlaps between petA locus and known QTLs for important agronomic traits

Preliminary data suggests patterns of selection on photosynthetic genes correlate with adaptation to different growing environments, offering a new perspective on photosynthetic adaptation during crop domestication. These findings parallel observed selection patterns in other carrot genes where cultivated variants show reduced nucleotide diversity compared to wild populations (π w/π c = 7.4 vs. 1.06 for the whole genome) .

How can systems biology approaches integrate Daucus carota Apocytochrome f research with broader understanding of carrot metabolism?

Systems biology approaches provide powerful frameworks for integrating Apocytochrome f research within the broader context of carrot metabolism:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to map relationships between photosynthetic electron transport and downstream metabolic pathways

  • Flux balance analysis: Developing computational models that quantify how alterations in electron transport rates impact metabolic flux distributions throughout primary and secondary metabolism

  • Network analysis: Constructing protein-protein interaction networks centered on Apocytochrome f to identify regulatory hubs and signaling connections

  • Cross-species comparative modeling: Leveraging data from model plants to build predictive models of carrot-specific metabolic adaptations

Implementation of these approaches has revealed unexpected connections between photosynthetic efficiency and specialized metabolite production in carrot, including carotenoid biosynthesis pathways that contribute to root color and nutritional quality. QTL analysis has identified genomic regions associated with both photosynthetic parameters and carotenoid accumulation, suggesting coordinated regulation .

Integrated models have successfully predicted how environmental stresses that impact electron transport cascaded through metabolism, explaining observed patterns of metabolite accumulation under field conditions. These system-level insights provide new targets for crop improvement strategies focused on enhancing both photosynthetic efficiency and nutritional quality traits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.