Recombinant Daucus carota ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methodology

The protein is produced via heterologous expression in E. coli, leveraging the following steps :

  1. Gene Cloning: Full-length atpI cDNA from D. carota is inserted into an E. coli-compatible vector.

  2. Induction: Protein expression is induced using IPTG.

  3. Purification: Affinity chromatography (Ni-NTA) isolates the His-tagged protein.

  4. Validation: Confirmed via SDS-PAGE and Western blot.

Optimization Challenges:

  • Acetate stress in E. coli reduces recombinant protein yields, but co-expression of stress-tolerant chaperones (e.g., DcHsp17.7 from carrot) enhances stability .

4.1. Mechanistic Studies

  • Proton Transport Dynamics: Used to dissect pH-dependent proton channel activity in chloroplasts .

  • ATP Synthase Assembly: Comparative studies with bacterial AtpI homologs reveal evolutionary conservation in rotor-stator interactions .

4.2. Biotechnological Relevance

  • Photosynthesis Engineering: Serves as a template for modifying ATP synthase efficiency in crops.

  • Structural Biology: Aids in cryo-EM and X-ray crystallography studies of plant ATP synthase architecture .

Unresolved Questions and Future Directions

  • Does D. carota AtpI require auxiliary factors for c-ring assembly, as observed in Propionigenium modestum ?

  • How do post-translational modifications in chloroplasts regulate AtpI function?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Daucus carota (Wild carrot)
Target Names
atpI
Target Protein Sequence
MNVLSCSINKLNGLYDISGVEVGQHFYWKIGGFQVHGQVLITSWVVIAILLGSATLAVRN PQTIPTSGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGISKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, this subunit plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Daucus carota chloroplasts?

ATP synthase subunit a in Daucus carota chloroplasts is a membrane-embedded component of the chloroplastic F₀F₁ ATP synthase complex. This complex catalyzes the final step of photophosphorylation, generating ATP using the proton motive force established across the thylakoid membrane during photosynthesis. Structurally, subunit a forms part of the membrane-embedded F₀ domain and contains multiple transmembrane helices that create a pathway for proton translocation across the membrane . This subunit works in conjunction with the c-ring to facilitate proton movement, which drives the rotation of the central stalk, ultimately leading to ATP synthesis in the F₁ domain.

How does chloroplastic ATP synthase subunit a differ from its mitochondrial counterpart?

Chloroplastic ATP synthase subunit a (atpI) differs from its mitochondrial counterpart in several key aspects:

  • Genetic origin: Chloroplastic atpI is encoded by the chloroplast genome, while mitochondrial subunit a is encoded by mitochondrial DNA (mtDNA) .

  • Structural adaptations: Chloroplastic subunit a has evolved specific structural features to function within the thylakoid membrane environment, optimized for integration with photosynthetic processes.

  • Proton pathway: While both facilitate proton translocation, the specific amino acid residues involved in creating the proton channel differ between the chloroplastic and mitochondrial versions.

  • Regulatory mechanisms: Chloroplastic ATP synthase is regulated by light-dependent processes and redox regulation, unlike mitochondrial ATP synthase which responds primarily to cellular energy status.

What expression systems are most effective for producing recombinant Daucus carota ATP synthase subunit a?

For recombinant expression of Daucus carota ATP synthase subunit a, Escherichia coli-based expression systems have proven effective when optimized properly. The following approach has shown promising results:

  • Vector selection: pET expression vectors (such as pET11a or pET26b) with strong T7 promoters provide good control over expression .

  • Host strain: E. coli BL21(DE3) is preferred due to its lack of certain proteases and compatibility with T7 expression systems .

  • Expression conditions: Induction with 0.5 mM IPTG at lower temperatures (16°C) for extended periods (20+ hours) significantly improves proper folding and reduces inclusion body formation .

  • Co-expression strategies: Co-expressing the target protein with molecular chaperones, particularly plant heat shock proteins such as DcHsp70 and DcHsp17.7 from Daucus carota itself, has been shown to enhance solubility and proper folding of membrane proteins .

What strategies can overcome the challenges of expressing chloroplastic membrane proteins like atpI in heterologous systems?

Expressing chloroplastic membrane proteins such as atpI presents several challenges that can be addressed through the following strategies:

  • Membrane mimetics: Incorporating membrane-mimetic environments during or after purification, such as detergent micelles, nanodiscs, or liposomes, helps maintain native-like structure.

  • Chaperone co-expression: Plant-derived heat shock proteins, particularly DcHsp17.7 and DcHsp70, have demonstrated superior ability to enhance membrane protein folding compared to bacterial counterparts (up to 13.0-fold and 11.6-fold improvement, respectively) .

  • Fusion partners: N-terminal fusion with solubility-enhancing tags like MBP (maltose-binding protein) or SUMO can improve expression outcomes.

  • Codon optimization: Adjusting the coding sequence to match the codon usage preferences of the host expression system while preserving critical structural elements.

  • Directed evolution approaches: Creating libraries of slightly modified variants and screening for improved expression and stability.

How can researchers accurately assess the functional integrity of recombinant atpI after purification?

Assessing functional integrity of recombinant atpI requires multiple complementary approaches:

  • Proton translocation assays: Reconstitution of purified atpI into liposomes containing pH-sensitive fluorescent dyes to measure proton movement across the membrane.

  • Interaction analysis: Using techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) to verify binding to other ATP synthase subunits, particularly the c-ring components.

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy to confirm proper secondary structure content, particularly the alpha-helical content expected for membrane-spanning domains.

  • Reconstitution experiments: Assembly of atpI with other ATP synthase components to assess if it can form part of a functional complex capable of ATP synthesis.

  • Site-directed mutagenesis: Creating variants with mutations at key functional residues (equivalent to the conserved arginine in mitochondrial subunit a, position 159 in humans) to confirm the expected loss of function .

What insights can comparative studies between plant and bacterial ATP synthase subunit a provide for evolutionary biology?

Comparative studies between plant chloroplastic and bacterial ATP synthase subunit a can reveal:

  • Evolutionary adaptation: Analysis of conserved motifs versus divergent regions highlights adaptations to different membrane environments and energy coupling mechanisms.

  • Endosymbiotic relationships: Chloroplastic atpI retains features from its cyanobacterial ancestors while acquiring plant-specific adaptations, providing insights into organellar evolution.

  • Structure-function relationships: Differences in proton pathways and interactions with the c-ring can reveal alternative mechanisms for accomplishing similar bioenergetic goals.

  • Selection pressures: Patterns of conservation in transmembrane domains versus loop regions reflect different evolutionary constraints.

What purification strategy yields the highest purity and activity for recombinant Daucus carota atpI?

A multi-stage purification strategy is recommended for recombinant atpI:

  • Initial extraction: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for membrane solubilization.

  • Affinity chromatography: Incorporate a 6-His tag at the N-terminus for initial purification using Ni-NTA resin under optimized conditions (20 mM imidazole for binding, 250 mM imidazole for elution) .

  • Size exclusion chromatography: Remove aggregates and further purify the protein based on size.

  • Ion exchange chromatography: Final polishing step to achieve highest purity.

  • Quality assessment: Verify purity through SDS-PAGE analysis (17% resolving gel recommended for membrane proteins of this size) .

How should researchers optimize co-expression of molecular chaperones with Daucus carota atpI?

Optimization of chaperone co-expression requires:

  • Chaperone selection: Plant heat shock proteins, particularly DcHsp17.7 and DcHsp70 from Daucus carota, have demonstrated superior effectiveness compared to bacterial counterparts like IbpA, IbpB, and DnaK .

  • Expression ratio optimization: Test different ratios of chaperone to target protein expression by varying promoter strengths or induction conditions.

  • Timing considerations: Sequential induction where chaperones are expressed first, followed by target protein induction.

  • Combined chaperone approaches: Co-expressing multiple chaperones, particularly the combination of DcHsp17.7-DcHsp70, has shown synergistic effects with enhancement of up to 13.8-fold in protein activity .

  • Growth conditions: Lowering the growth temperature to 16°C during induction significantly improves proper folding while still allowing chaperone assistance .

What spectroscopic methods are most informative for structural characterization of recombinant atpI?

The following spectroscopic approaches provide complementary structural information:

  • Circular Dichroism (CD): For secondary structure determination, particularly alpha-helical content (expected to be high in transmembrane segments).

  • Fourier-Transform Infrared Spectroscopy (FTIR): Provides information about protein secondary structure in membrane environments.

  • Nuclear Magnetic Resonance (NMR): For detailed structural characterization of specific domains or interactions, though challenging for the full protein due to size.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To identify solvent-exposed regions versus protected domains.

  • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or introduced fluorescent probes to assess tertiary structure integrity.

How can researchers distinguish between folding issues and inherent properties when analyzing recombinant atpI?

Distinguishing between folding problems and inherent properties requires:

  • Comparative analysis: Parallel expression and characterization of both wild-type and known functional mutants.

  • Thermal stability assessment: Properly folded membrane proteins typically show cooperative unfolding transitions in thermal denaturation experiments.

  • Detergent screening: Testing multiple detergents to determine if apparent properties are detergent-dependent (suggesting folding issues) or consistent across conditions (suggesting inherent properties).

  • Native control comparison: When possible, comparing properties with the native protein isolated directly from Daucus carota chloroplasts.

  • Activity correlation: Establishing relationships between structural parameters and functional measures to identify properly folded species.

What are the most common pitfalls in interpreting functional assays for chloroplastic ATP synthase components?

Key considerations for interpreting functional assays include:

  • Detergent interference: Many detergents can affect proton permeability or create artifacts in functional assays.

  • Reconstitution efficiency: Variable incorporation into liposomes or nanodiscs can lead to inconsistent results.

  • Component stoichiometry: Ensuring proper ratios of ATP synthase components in reconstitution experiments.

  • Orientation in membranes: Asymmetric membrane proteins must insert with the correct orientation for function.

  • Buffer effects: Proton-based assays are highly sensitive to buffer composition and capacity.

How should researchers approach contradictory results between different functional assays of recombinant atpI?

When faced with contradictory results:

  • Assay validation: Verify each assay using positive and negative controls with known outcomes.

  • Condition matching: Ensure buffer conditions, pH, ionic strength, and temperature are consistent across assays.

  • Protein quality assessment: Check for degradation, aggregation, or heterogeneity in the protein sample.

  • Detergent effects: Evaluate whether different detergents used in various assays could explain discrepancies.

  • Component interactions: Consider whether the presence or absence of other ATP synthase components affects the results.

What cryo-EM approaches are most promising for structural determination of chloroplastic ATP synthase with recombinant components?

Promising cryo-EM strategies include:

  • Amphipol reconstitution: Replacing detergents with amphipathic polymers that stabilize membrane proteins without forming micelles.

  • Focused refinement: Applying computational approaches that focus on specific domains to overcome flexibility challenges.

  • Partial complex assembly: Building up the complex step-by-step to understand the contribution of each component.

  • Lipid nanodisc incorporation: Embedding the protein complex in defined lipid nanodiscs to provide a more native-like environment.

  • Time-resolved studies: Capturing different conformational states during the catalytic cycle using methods like time-resolved cryo-EM.

How can site-directed mutagenesis of recombinant atpI advance understanding of proton translocation mechanisms?

Strategic site-directed mutagenesis can:

  • Target conserved residues: Modify highly conserved amino acids equivalent to the arginine at position 159 in human subunit a to validate their role in proton translocation .

  • Alter hydrophilic residues: Modify residues that potentially form the proton pathway to determine their specific contributions.

  • Investigate helix-helix interactions: Mutate residues at predicted interfaces between transmembrane helices to understand structural dynamics.

  • Engineer cross-linkable residues: Introduce cysteines at strategic positions to verify proximity relationships through disulfide cross-linking.

  • Create chimeric proteins: Swap domains between different species to identify species-specific functional adaptations.

What computational approaches can predict the impact of mutations on atpI structure and function?

Advanced computational methods include:

  • Molecular dynamics simulations: Simulate the behavior of wild-type and mutant proteins in membrane environments over nanosecond to microsecond timescales.

  • Homology modeling: Build structural models based on related proteins with known structures, particularly leveraging recently resolved cryo-EM structures of ATP synthases .

  • Electrostatic calculations: Predict changes in proton pathways resulting from mutations of charged residues.

  • Machine learning approaches: Apply neural networks trained on protein structure-function relationships to predict the impact of novel mutations.

  • Quantum mechanics/molecular mechanics (QM/MM) methods: For detailed analysis of proton transfer events at the atomic level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.